Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against beta glucuronidase (GUSB) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human beta glucuronidase (GUSB) (NP_000172.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against beta glucuronidase (GUSB) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human beta glucuronidase (GUSB) (NP_000172.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13520A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | beta glucuronidase (GUSB) |
| Target Synonyms | BG; MPS7; beta glucuronidase (GUSB) | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HepG2, HL-60 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human beta glucuronidase (GUSB) (NP_000172.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MARGSAVAWAALGPLLWGCALGLQGGMLYPQESPSRECKELDGLWSFRADFSDNRRRGFEEQWYRRPLWESGPTVDMPVPSSFNDISQDWRLRHFVGWVW | Uniprot ID | P08236 |
Uniprot Id
P08236
Target Species
Human
Target Name
GUSB
Target Full Name
Beta-glucuronidase
Target Function
Plays an important role in the degradation of dermatan and keratan sulfates.
Target Involvement
Mucopolysaccharidosis 7 (MPS7)
Target Subcellular Location
Lysosome.
Target Protein Families
Glycosyl hydrolase 2 family
Target Synonyms
Ac2-223; asd; Beta G1; Beta glucuronidase; Beta-G1; Beta-glucuronidase; BG; BGLR; BGLR_HUMAN; FLJ39445; Glucuronidase beta; Gur; Gus; Gus-r; Gus-s; Gus-t; Gus-u; GUSB; Gut; MPS7
Target Background
This gene encodes a hydrolase that degrades glycosaminoglycans, including heparan sulfate, dermatan sulfate, and chondroitin-4, 6-sulfate. The enzyme forms a homotetramer that is localized to the lysosome. Mutations in this gene result in mucopolysaccharidosis type VII. Alternative splicing results in multiple transcript variants. There are many pseudogenes of this locus in the human genome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
