-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BIN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 511-593 of human BIN1 (NP_647593.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against BIN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 511-593 of human BIN1 (NP_647593.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-15655A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BIN1 |
| Target Synonyms | CNM2; AMPH2; AMPHL; SH3P9; BIN1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C2C12 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 511-593 of human BIN1 (NP_647593.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP | Uniprot ID | O00499 |
Uniprot Id
O00499
Target Species
Human
Target Name
BIN1
Target Full Name
Myc box-dependent-interacting protein 1
Target Function
Is a key player in the control of plasma membrane curvature, membrane shaping and membrane remodeling. Required in muscle cells for the formation of T-tubules, tubular invaginations of the plasma membrane that function in depolarization-contraction coupling. Is a negative regulator of endocytosis. Is also involved in the regulation of intracellular vesicles sorting, modulation of BACE1 trafficking and the control of amyloid-beta production. In neuronal circuits, endocytosis regulation may influence the internalization of PHF-tau aggregates. May be involved in the regulation of MYC activity and the control cell proliferation. Has actin bundling activity and stabilizes actin filaments against depolymerization in vitro.
Target Involvement
Myopathy, centronuclear, 2 (CNM2)
Target Subcellular Location
[Isoform BIN1]: Nucleus. Cytoplasm. Endosome. Cell membrane, sarcolemma, T-tubule.; [Isoform IIA]: Cytoplasm.
Target Tissue Specificity
Ubiquitous. Highest expression in the brain and muscle. Expressed in oligodendrocytes. Isoform IIA is expressed only in the brain, where it is detected in the gray matter, but not in the white matter. Isoform BIN1 is widely expressed with highest expressi
Target Synonyms
AMPH 2; AMPH2; Amphiphysin 2; Amphiphysin II; Amphiphysin like protein; amphiphysin-like; Amphiphysin-like protein; AMPHL; Bin1; BIN1_HUMAN; Box Dependant MYC Interacting Protein 1; Box-dependent myc-interacting protein 1; Bridging integrator 1; DKFZp547F068; MGC10367; MGC105358; Myc box dependent interacting protein 1; Myc box-dependent-interacting protein 1; SH3P9
Target Background
This gene encodes several isoforms of a nucleocytoplasmic adaptor protein, one of which was initially identified as a MYC-interacting protein with features of a tumor suppressor. Isoforms that are expressed in the central nervous system may be involved in synaptic vesicle endocytosis and may interact with dynamin, synaptojanin, endophilin, and clathrin. Isoforms that are expressed in muscle and ubiquitously expressed isoforms localize to the cytoplasm and nucleus and activate a caspase-independent apoptotic process. Studies in mouse suggest that this gene plays an important role in cardiac muscle development. Alternate splicing of the gene results in several transcript variants encoding different isoforms. Aberrant splice variants expressed in tumor cell lines have also been described.
Notification