Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Brachyury was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 266-435 of human Brachyury (O15178) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Brachyury was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 266-435 of human Brachyury (O15178) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14162A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Brachyury |
| Target Synonyms | T; TFT; SAVA; Brachyury | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse thymus, NCI-H460 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 266-435 of human Brachyury (O15178). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNWSSLGMPAHPSMLPVSHNASPPTSSSQYPSLWSVSNGAVTPGSQAAAVSNGLGAQFFRGSPAHYTPLTHPVSAPSSSGSPLYEGAAAATDIVDSQYDAAAQGRLIASWTPVSPPSM | Uniprot ID | O15178 |
Uniprot Id
O15178
Target Species
Human
Target Name
TBXT
Target Full Name
T-box transcription factor T
Target Function
Involved in the transcriptional regulation of genes required for mesoderm formation and differentiation. Binds to a palindromic T site 5'-TTCACACCTAGGTGTGAA-3' DNA sequence and activates gene transcription when bound to such a site.
Target Involvement
Neural tube defects (NTD); Chordoma (CHDM); Sacral agenesis with vertebral anomalies (SAVA)
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Detected in testis, but not in other, normal tissues. Detected in lung tumors (at protein level).
Target Synonyms
BRAC_HUMAN; Brachyury homolog; Brachyury protein; Bry; MGC104817; Protein T; SAVA; T; T brachyury homolog; T brachyury transcription factor; T Protein; T, brachyury homolog (mouse); TFT; Transcription factor T
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
