-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against C-Reactive Protein (CRP) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 125-224 of human C-Reactive Protein (CRP) (P02741) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against C-Reactive Protein (CRP) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 125-224 of human C-Reactive Protein (CRP) (P02741) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-15933A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | C-Reactive Protein (CRP) |
| Target Synonyms | PTX1; C-Reactive Protein (CRP) | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | human serum, Mouse serum | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 125-224 of human C-Reactive Protein (CRP) (P02741). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP | Uniprot ID | P02741 |
Uniprot Id
P02741
Target Species
Human
Target Name
CRP
Target Full Name
C-reactive protein
Target Function
Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells.
Target Subcellular Location
Secreted.
Target Protein Families
Pentraxin family
Target Tissue Specificity
Found in plasma.
Target Synonyms
PTX1; C-Reactive Protein (CRP)
Target Background
The protein encoded by this gene belongs to the pentraxin family which also includes serum amyloid P component protein and pentraxin 3. Pentraxins are involved in complement activation and amplification via communication with complement initiation pattern recognition molecules, but also complement regulation via recruitment of complement regulators. The encoded protein has a calcium dependent ligand binding domain with a distinctive flattened beta-jellyroll structure. It exists in two forms as either a pentamer in circulation or as a nonsoluble monomer in tissues. It is involved in several host defense related functions based on its ability to recognize foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli. Elevated expression of the encoded protein is associated with severe acute respiratory syndrome coronavirus 2 (SARS‐CoV‐2) infection.
Notification