-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Carbonic Anhydrase 9 (CA9/G250) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human Carbonic Anhydrase 9 (CA9/G250) (Q16790) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Carbonic Anhydrase 9 (CA9/G250) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human Carbonic Anhydrase 9 (CA9/G250) (Q16790) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16466A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Carbonic Anhydrase 9 (CA9/G250) |
| Target Synonyms | MN; CAIX; Carbonic Anhydrase 9 (CA9/G250) | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, SW620 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Carbonic Anhydrase 9 (CA9/G250) (Q16790). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HSVQLTLPPGLEMALGPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTAFARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEIA | Uniprot ID | Q16790 |
Uniprot Id
Q16790
Target Species
Human
Target Name
CA9
Target Full Name
Carbonic anhydrase 9
Target Function
Reversible hydration of carbon dioxide. Participates in pH regulation. May be involved in the control of cell proliferation and transformation. Appears to be a novel specific biomarker for a cervical neoplasia.
Target Subcellular Location
Nucleus. Nucleus, nucleolus. Cell membrane; Single-pass type I membrane protein. Cell projection, microvillus membrane; Single-pass type I membrane protein. Note=Found on the surface microvilli and in the nucleus, particularly in nucleolus.
Target Protein Families
Alpha-carbonic anhydrase family
Target Tissue Specificity
Expressed primarily in carcinoma cells lines. Expression is restricted to very few normal tissues and the most abundant expression is found in the epithelial cells of gastric mucosa.
Target Research Area
Metabolism
Target Synonyms
CA-IX; CA9; CAH9_HUMAN; CAIX; Carbonate dehydratase IX; Carbonic anhydrase 9; Carbonic anhydrase IX; Carbonic dehydratase; G250; Membrane antigen MN; MN; P54/58N; pMW1; RCC associated protein G250; RCC-associated antigen G250; Renal cell carcinoma-associated antigen G250
Target Background
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IX is a transmembrane protein and is one of only two tumor-associated carbonic anhydrase isoenzymes known. It is expressed in all clear-cell renal cell carcinoma, but is not detected in normal kidney or most other normal tissues. It may be involved in cell proliferation and transformation. This gene was mapped to 17q21.2 by fluorescence in situ hybridization, however, radiation hybrid mapping localized it to 9p13-p12.
Notification