-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cathepsin E (CTSE) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 132-244 of human Cathepsin E (CTSE) (NP_001901.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Cathepsin E (CTSE) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 132-244 of human Cathepsin E (CTSE) (NP_001901.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14749A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cathepsin E (CTSE) |
| Target Synonyms | CATE; Cathepsin E (CTSE) | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen, Mouse stomach, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 132-244 of human Cathepsin E (CTSE) (NP_001901.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGS | Uniprot ID | P14091 |
Uniprot Id
P14091
Target Species
Human
Target Name
CTSE
Target Full Name
Cathepsin E
Target Function
May have a role in immune function. Probably involved in the processing of antigenic peptides during MHC class II-mediated antigen presentation. May play a role in activation-induced lymphocyte depletion in the thymus, and in neuronal degeneration and glial cell activation in the brain.
Target Subcellular Location
Endosome. Note=The proenzyme is localized to the endoplasmic reticulum and Golgi apparatus, while the mature enzyme is localized to the endosome.
Target Protein Families
Peptidase A1 family
Target Tissue Specificity
Expressed abundantly in the stomach, the Clara cells of the lung and activated B-lymphocytes, and at lower levels in lymph nodes, skin and spleen. Not expressed in resting B-lymphocytes.
Target Synonyms
CATE; CATE_HUMAN; Cathepsin E; Cathepsin E form II; CTSE; Erythrocyte membrane aspartic proteinase ; Slow moving proteinase
Target Background
This gene encodes a member of the A1 family of peptidases. Alternative splicing of this gene results in multiple transcript variants. At least one of these variants encodes a preproprotein that is proteolytically processed to generate the mature enzyme. This enzyme, an aspartic endopeptidase, may be involved in antigen processing and the maturation of secretory proteins. Elevated expression of this gene has been observed in neurodegeneration.
Notification