-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CBS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 400-551 of human CBS (P35520) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CBS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 400-551 of human CBS (P35520) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16561A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CBS |
| Target Synonyms | CBSL; HIP4; CBS | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, HepG2, MCF7, Mouse liver, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 400-551 of human CBS (P35520). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK | Uniprot ID | P35520 |
Uniprot Id
P35520
Target Species
Human
Target Name
CBS
Target Full Name
Cystathionine beta-synthase
Target Function
Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L-homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine. Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons.
Target Involvement
Cystathionine beta-synthase deficiency (CBSD)
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Cysteine synthase/cystathionine beta-synthase family
Target Tissue Specificity
In the adult strongly expressed in liver and pancreas, some expression in heart and brain, weak expression in lung and kidney. In the fetus, expressed in brain, liver and kidney.
Target Research Area
Metabolism
Target Synonyms
AI047524; AI303044; Beta thionase; Beta-thionase; Cbs; Cbs cystathionine beta-synthase; CBS_HUMAN; Cystathionine beta synthase; Cystathionine beta-synthase; EC 4.2.1.22; HIP 4; HIP4; Methylcysteine synthase; MGC18856; MGC18895; MGC37300; OTTHUMP00000109416; OTTHUMP00000109418; Serine sulfhydrase
Target Background
The protein encoded by this gene acts as a homotetramer to catalyze the conversion of homocysteine to cystathionine, the first step in the transsulfuration pathway. The encoded protein is allosterically activated by adenosyl-methionine and uses pyridoxal phosphate as a cofactor. Defects in this gene can cause cystathionine beta-synthase deficiency (CBSD), which can lead to homocystinuria. This gene is a major contributor to cellular hydrogen sulfide production. Multiple alternatively spliced transcript variants have been found for this gene.
Notification