-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD13/ANPEP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human CD13/ANPEP (P15144) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CD13/ANPEP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human CD13/ANPEP (P15144) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16778A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD13/ANPEP |
| Target Synonyms | APN; AP-M; AP-N; CD13; LAP1; P150; PEPN; hAPN; GP150; CD13/ANPEP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat kidney, THP-1 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human CD13/ANPEP (P15144). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NAGAMENWGLVTYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYLGADYAEPTWNLKDLMVLNDVYRVMAVDALA | Uniprot ID | P15144 |
Uniprot Id
P15144
Target Species
Human
Target Name
ANPEP
Target Full Name
Aminopeptidase N
Target Function
Broad specificity aminopeptidase which plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Also involved in the processing of various peptides including peptide hormones, such as angiotensin III and IV, neuropeptides, and chemokines. May also be involved the cleavage of peptides bound to major histocompatibility complex class II molecules of antigen presenting cells. May have a role in angiogenesis and promote cholesterol crystallization. May have a role in amino acid transport by acting as binding partner of amino acid transporter SLC6A19 and regulating its activity.; (Microbial infection) Acts as a receptor for human coronavirus 229E/HCoV-229E. In case of human coronavirus 229E (HCoV-229E) infection, serves as receptor for HCoV-229E spike glycoprotein.; (Microbial infection) Mediates as well Human cytomegalovirus (HCMV) infection.
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Target Protein Families
Peptidase M1 family
Target Tissue Specificity
Expressed in epithelial cells of the kidney, intestine, and respiratory tract; granulocytes, monocytes, fibroblasts, endothelial cells, cerebral pericytes at the blood-brain barrier, synaptic membranes of cells in the CNS. Also expressed in endometrial st
Target Research Area
Immunology
Target Synonyms
Alanyl (membrane) aminopeptidase; Alanyl aminopeptidase; Aminopeptidase M; Aminopeptidase N; AMPN_HUMAN; ANPEP; AP M; AP N; AP-M; AP-N; APN; CD 13; CD13; CD13 antigen; gp150; hAPN; LAP 1; LAP1; Microsomal aminopeptidase; Myeloid plasma membrane glycoprotein CD13; p150; PEPN
Target Background
Aminopeptidase N is located in the small-intestinal and renal microvillar membrane, and also in other plasma membranes. In the small intestine aminopeptidase N plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Its function in proximal tubular epithelial cells and other cell types is less clear. The large extracellular carboxyterminal domain contains a pentapeptide consensus sequence characteristic of members of the zinc-binding metalloproteinase superfamily. Sequence comparisons with known enzymes of this class showed that CD13 and aminopeptidase N are identical. The latter enzyme was thought to be involved in the metabolism of regulatory peptides by diverse cell types, including small intestinal and renal tubular epithelial cells, macrophages, granulocytes, and synaptic membranes from the CNS. This membrane-bound zinc metalloprotease is known to serve as a receptor for the HCoV-229E alphacoronavirus as well as other non-human coronaviruses. This gene has also been shown to promote angiogenesis, tumor growth, and metastasis and defects in this gene are associated with various types of leukemia and lymphoma.
Notification