Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDCA5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 153-252 of human CDCA5 (Q96FF9) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CDCA5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 153-252 of human CDCA5 (Q96FF9) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16250A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDCA5 |
| Target Synonyms | SORORIN; CDCA5 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 153-252 of human CDCA5 (Q96FF9). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE | Uniprot ID | Q96FF9 |
Uniprot Id
Q96FF9
Target Species
Human
Target Name
CDCA5
Target Full Name
Sororin
Target Function
Regulator of sister chromatid cohesion in mitosis stabilizing cohesin complex association with chromatin. May antagonize the action of WAPL which stimulates cohesin dissociation from chromatin. Cohesion ensures that chromosome partitioning is accurate in both meiotic and mitotic cells and plays an important role in DNA repair. Required for efficient DNA double-stranded break repair.
Target Subcellular Location
Nucleus. Chromosome. Cytoplasm. Note=Associates with nuclear chromatin from S phase until metaphase and is released in the cytoplasm upon nuclear envelope breakdown.
Target Protein Families
Sororin family
Target Synonyms
CDCA5; CDCA5_HUMAN; Cell division cycle associated protein 5; Cell division cycle-associated protein 5; MGC16386; p35; Sororin
Target Background
Predicted to enable chromatin binding activity. Involved in double-strand break repair; mitotic sister chromatid segregation; and regulation of cell cycle process. Located in nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
