-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CEACAM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 427-526 of human CEACAM1 (P13688) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CEACAM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 427-526 of human CEACAM1 (P13688) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16008A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CEACAM1 |
| Target Synonyms | BGP; BGP1; BGPI; CEACAM1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 427-526 of human CEACAM1 (P13688). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PGAIAGIVIGVVALVALIAVALACFLHFGKTGRASDQRDLTEHKPSVSNHTQDHSNDPPNKMNEVTYSTLNFEAQQPTQPTSASPSLTATEIIYSEVKKQ | Uniprot ID | P13688 |
Uniprot Id
P13688
Target Species
Human
Target Name
CEACAM1
Target Full Name
Cell adhesion molecule CEACAM1
Target Function
Cell adhesion protein that mediates homophilic cell adhesion in a calcium-independent manner. Plays a role as coinhibitory receptor in immune response, insulin action and functions also as an activator during angiogenesis. Its coinhibitory receptor function is phosphorylation- and PTPN6 -dependent, which in turn, suppress signal transduction of associated receptors by dephosphorylation of their downstream effectors. Plays a role in immune response, of T cells, natural killer (NK) and neutrophils. Upon TCR/CD3 complex stimulation, inhibits TCR-mediated cytotoxicity by blocking granule exocytosis by mediating homophilic binding to adjacent cells, allowing interaction with and phosphorylation by LCK and interaction with the TCR/CD3 complex which recruits PTPN6 resulting in dephosphorylation of CD247 and ZAP70. Also inhibits T cell proliferation and cytokine production through inhibition of JNK cascade and plays a crucial role in regulating autoimmunity and anti-tumor immunity by inhibiting T cell through its interaction with HAVCR2. Upon natural killer (NK) cells activation, inhibit KLRK1-mediated cytolysis of CEACAM1-bearing tumor cells by trans-homophilic interactions with CEACAM1 on the target cell and lead to cis-interaction between CEACAM1 and KLRK1, allowing PTPN6 recruitment and then VAV1 dephosphorylation. Upon neutrophils activation negatively regulates IL1B production by recruiting PTPN6 to a SYK-TLR4-CEACAM1 complex, that dephosphorylates SYK, reducing the production of reactive oxygen species (ROS) and lysosome disruption, which in turn, reduces the activity of the inflammasome. Downregulates neutrophil production by acting as a coinhibitory receptor for CSF3R by downregulating the CSF3R-STAT3 pathway through recruitment of PTPN6 that dephosphorylates CSF3R. Also regulates insulin action by promoting INS clearance and regulating lipogenesis in liver through regulating insulin signaling. Upon INS stimulation, undergoes phosphorylation by INSR leading to INS clearance by increasing receptor-mediated insulin endocytosis. This inernalization promotes interaction with FASN leading to receptor-mediated insulin degradation and to reduction of FASN activity leading to negative regulation of fatty acid synthesis. INSR-mediated phosphorylation also provokes a down-regulation of cell proliferation through SHC1 interaction resulting in decrease coupling of SHC1 to the MAPK3/ERK1-MAPK1/ERK2 and phosphatidylinositol 3-kinase pathways. Functions as activator in angiogenesis by promoting blood vessel remodeling through endothelial cell differentiation and migration and in arteriogenesis by increasing the number of collateral arteries and collateral vessel calibers after ischemia. Also regulates vascular permeability through the VEGFR2 signaling pathway resulting in control of nitric oxide production. Downregulates cell growth in response to EGF through its interaction with SHC1 that mediates interaction with EGFR resulting in decrease coupling of SHC1 to the MAPK3/ERK1-MAPK1/ERK2 pathway. Negatively regulates platelet aggregation by decreasing platelet adhesion on type I collagen through the GPVI-FcRgamma complex. Inhibits cell migration and cell scattering through interaction with FLNA; interfers with the interaction of FLNA with RALA. Mediates bile acid transport activity in a phosphorylation dependent manner. Negatively regulates osteoclastogenesis.; Cell adhesion protein that mediates homophilic cell adhesion in a calcium-independent manner. Promotes populations of T cells regulating IgA production and secretion associated with control of the commensal microbiota and resistance to enteropathogens.
Target Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein. Lateral cell membrane. Apical cell membrane. Basal cell membrane. Cell junction. Cell junction, adherens junction.; [Isoform 2]: Secreted.; [Isoform 3]: Secreted.; [Isoform 4]: Secreted.; [Isoform 5]: Cell membrane; Single-pass type I membrane protein.; [Isoform 6]: Cell membrane; Single-pass type I membrane protein.; [Isoform 7]: Cell membrane; Single-pass type I membrane protein.; [Isoform 8]: Cell membrane; Single-pass type I membrane protein. Cytoplasmic vesicle, secretory vesicle membrane. Lateral cell membrane. Apical cell membrane. Basal cell membrane. Cell junction. Cell junction, adherens junction.; Cell projection, microvillus membrane; Single-pass type I membrane protein. Apical cell membrane; Single-pass type I membrane protein.
Target Protein Families
Immunoglobulin superfamily, CEA family
Target Tissue Specificity
Expressed in columnar epithelial cells of the colon (at protein level). The predominant forms expressed by T cells are those containing a long cytoplasmic domain. Expressed in granulocytes and lymphocytes. Leukocytes only express isoforms 6 and isoform 1.
Target Research Area
Tags & Cell Markers
Target Synonyms
Antigen CD66; BGP 1; BGP; BGP-1; BGPI; Biliary glycoprotein 1; Biliary glycoprotein adhesion molecule; Biliary glycoprotein; Carcinoembryonic antigen related cell adhesion molecule 1; carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein); Carcinoembryonic antigen-related cell adhesion molecule 1; CD66a; CD66a antigen; CEACAM1; CEAM1_HUMAN; meconium antigen 100
Target Background
This gene encodes a member of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily. Two subgroups of the CEA family, the CEA cell adhesion molecules and the pregnancy-specific glycoproteins, are located within a 1.2 Mb cluster on the long arm of chromosome 19. Eleven pseudogenes of the CEA cell adhesion molecule subgroup are also found in the cluster. The encoded protein was originally described in bile ducts of liver as biliary glycoprotein. Subsequently, it was found to be a cell-cell adhesion molecule detected on leukocytes, epithelia, and endothelia. The encoded protein mediates cell adhesion via homophilic as well as heterophilic binding to other proteins of the subgroup. Multiple cellular activities have been attributed to the encoded protein, including roles in the differentiation and arrangement of tissue three-dimensional structure, angiogenesis, apoptosis, tumor suppression, metastasis, and the modulation of innate and adaptive immune responses. Multiple transcript variants encoding different isoforms have been reported, but the full-length nature of all variants has not been defined.
Notification