-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLPP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 178-277 of human CLPP (Q16740) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CLPP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 178-277 of human CLPP (Q16740) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14142A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLPP |
| Target Synonyms | DFNB81; PRLTS3; CLPP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Hep G2, Mouse liver, Rat liver, SW620 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 178-277 of human CLPP (Q16740). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST | Uniprot ID | Q16740 |
Uniprot Id
Q16740
Target Species
Human
Target Name
CLPP
Target Full Name
ATP-dependent Clp protease proteolytic subunit, mitochondrial
Target Function
Protease component of the Clp complex that cleaves peptides and various proteins in an ATP-dependent process. Has low peptidase activity in the absence of CLPX. The Clp complex can degrade CSN1S1, CSN2 and CSN3, as well as synthetic peptides (in vitro) and may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates. Cleaves PINK1 in the mitochondrion.
Target Involvement
Perrault syndrome 3 (PRLTS3)
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
Peptidase S14 family
Target Tissue Specificity
Detected in liver (at protein level). Predominantly expressed in skeletal muscle. Intermediate levels in heart, liver and pancreas. Low in brain, placenta, lung and kidney.
Target Synonyms
ATP dependent protease ClpAP (E coli) proteolytic subunit; ATP dependent protease ClpAP proteolytic subunit; ATP dependent protease ClpAP proteolytic subunit human; ATP dependent proteolytic subunit homolog (E coli); ATP dependent proteolytic subunit homolog; Caseinolytic peptidase ATP dependent proteolytic subunit homolog; Caseinolytic protease ATP dependent proteolytic subunit E coli; clpP; ClpP caseinolytic peptidase ATP dependent proteolytic subunit; ClpP caseinolytic peptidase ATP dependent proteolytic subunit homolog; CLPP_HUMAN; Endopeptidase Clp; mitochondrial; Putative ATP dependent Clp protease proteolytic subunit mitochondrial; Putative ATP dependent Clp protease proteolytic subunit; Putative ATP-dependent Clp protease proteolytic subunit
Target Background
The protein encoded by this gene belongs to the peptidase family S14 and hydrolyzes proteins into small peptides in the presence of ATP and magnesium. The protein is transported into mitochondrial matrix and is associated with the inner mitochondrial membrane.
Notification