-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CoREST/RCOR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CoREST/RCOR1 (Q9UKL0) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ChIP, ELISA.
The antibody against CoREST/RCOR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CoREST/RCOR1 (Q9UKL0) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ChIP, ELISA.
| Cat.No | ADA-16202A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CoREST/RCOR1 |
| Target Synonyms | RCOR; COREST; CoREST/RCOR1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C2C12, HepG2, HT-29 | Application | ELISA, WB, ChIP, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CoREST/RCOR1 (Q9UKL0). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPAMVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAASAAAAPNNGQNKSLAAAAPNGNSSSNSWEEGSSGSSSDEEH | Uniprot ID | Q9UKL0 |
Uniprot Id
Q9UKL0
Target Species
Human
Target Name
RCOR1
Target Full Name
REST corepressor 1
Target Function
Essential component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. In the BHC complex, it serves as a molecular beacon for the recruitment of molecular machinery, including MeCP2 and SUV39H1, that imposes silencing across a chromosomal interval. Plays a central role in demethylation of Lys-4 of histone H3 by promoting demethylase activity of KDM1A on core histones and nucleosomal substrates. It also protects KDM1A from the proteasome. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development and controls hematopoietic differentiation.
Target Subcellular Location
Nucleus. Note=Upon infection by HSV-1, it is partially translocated into the cytoplasm in an HSV-1-dependent manner.
Target Protein Families
CoREST family
Target Tissue Specificity
Ubiquitously expressed.
Target Research Area
Cancer
Target Synonyms
COREST; KIAA0071; Nr2b2; Nuclear receptor coregulator 1; Nuclear receptor subfamily 2 group B member 2; Protein CoREST; RCOR; Rcor1; RCOR1_HUMAN; REST corepressor 1; Retinoic acid receptor RXR-beta; Retinoid X receptor beta; Rxrb
Target Background
This gene encodes a protein that is well-conserved, downregulated at birth, and with a specific role in determining neural cell differentiation. The encoded protein binds to the C-terminal domain of REST (repressor element-1 silencing transcription factor).
Notification