-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CPS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1356-1482 of human CPS1 (NP_001116105.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CPS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1356-1482 of human CPS1 (NP_001116105.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-15588A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CPS1 |
| Target Synonyms | PHN; GATD6; CPSASE1; CPS1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Bewo | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1356-1482 of human CPS1 (NP_001116105.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KIPQKGILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRK | Uniprot ID | P31327 |
Uniprot Id
P31327
Target Species
Human
Target Name
CPS1
Target Full Name
Carbamoyl-phosphate synthase [ammonia], mitochondrial
Target Function
Involved in the urea cycle of ureotelic animals where the enzyme plays an important role in removing excess ammonia from the cell.
Target Involvement
Carbamoyl phosphate synthetase 1 deficiency (CPS1D); Pulmonary hypertension, neonatal (PHN)
Target Subcellular Location
Mitochondrion. Nucleus, nucleolus.
Target Tissue Specificity
Primarily in the liver and small intestine.
Target Research Area
Signal Transduction, Cancer
Target Synonyms
Carbamoyl phosphate synthase [ammonia]; Carbamoyl phosphate synthase [ammonia] mitochondrial; Carbamoyl phosphate synthase; Carbamoyl phosphate synthetase 1; Carbamoyl phosphate synthetase 1 mitochondrial; Carbamoyl phosphate synthetase I; Carbamoyl-phosphate synthase [ammonia]; Carbamoyl-phosphate synthetase I; Carbamoylphosphate synthase; Carbamoylphosphate synthetase 1; Carbamoylphosphate synthetase I; CPS 1; Cps1; CPSase 1; CPSase I; CPSASE1; CPSM_HUMAN; mitochondrial; MS738
Target Background
The mitochondrial enzyme encoded by this gene catalyzes synthesis of carbamoyl phosphate from ammonia and bicarbonate. This reaction is the first committed step of the urea cycle, which is important in the removal of excess urea from cells. The encoded protein may also represent a core mitochondrial nucleoid protein. Three transcript variants encoding different isoforms have been found for this gene. The shortest isoform may not be localized to the mitochondrion. Mutations in this gene have been associated with carbamoyl phosphate synthetase deficiency, susceptibility to persistent pulmonary hypertension, and susceptibility to venoocclusive disease after bone marrow transplantation.
Notification