-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cystatin B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-98 of human Cystatin B (NP_000091.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Cystatin B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-98 of human Cystatin B (NP_000091.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13531A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cystatin B |
| Target Synonyms | PME; ULD; CST6; EPM1; STFB; CPI-B; EPM1A; Cystatin B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, HL-60 (Low expression control), Mouse liver, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-98 of human Cystatin B (NP_000091.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF | Uniprot ID | P04080 |
Uniprot Id
P04080
Target Species
Human
Target Name
CSTB
Target Full Name
Cystatin-B
Target Function
This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B.
Target Involvement
Epilepsy, progressive myoclonic 1 (EPM1)
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Cystatin family
Target Research Area
Cell Biology
Target Synonyms
CHROW21; CPI B; CPI-B; CST 6; CST6; CSTB; Cystatin B (stefin B); Cystatin B; Cystatin-B; CYTB; CYTB_HUMAN; EPM1; EPM1A; Liver thiol proteinase inhibitor; PME; Stefin-B; STF B; STFB; ULD
Target Background
The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and kininogens. This gene encodes a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy (EPM1). One type of mutation responsible for EPM1 is the expansion in the promoter region of this gene of a CCCCGCCCCGCG repeat from 2-3 copies to 30-78 copies.
Notification