-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cytokeratin 2e (KRT2) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 293-422 of humanKRT2(P35908) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Cytokeratin 2e (KRT2) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 293-422 of humanKRT2(P35908) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14434A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cytokeratin 2e (KRT2) |
| Target Synonyms | K2e; KRTE; CK-2e; KRT2A; KRT2E; Cytokeratin 2e (KRT2) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 293-422 of humanKRT2(P35908). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YMIKVELQSKVDLLNQEIEFLKVLYDAEISQIHQSVTDTNVILSMDNSRNLDLDSIIAEVKAQYEEIAQRSKEEAEALYHSKYEELQVTVGRHGDSLKEIKIEISELNRVIQRLQGEIAHVKKQCKNVQD | Uniprot ID | P35908 |
Uniprot Id
P35908
Target Species
Human
Target Name
KRT2
Target Full Name
Keratin, type II cytoskeletal 2 epidermal
Target Function
Probably contributes to terminal cornification. Associated with keratinocyte activation, proliferation and keratinization. Plays a role in the establishment of the epidermal barrier on plantar skin.
Target Involvement
Ichthyosis bullosa of Siemens (IBS)
Target Protein Families
Intermediate filament family
Target Tissue Specificity
Expressed in the upper spinous and granular suprabasal layers of normal adult epidermal tissues from most body sites including thigh, breast nipple, foot sole, penile shaft and axilla. Not present in foreskin, squamous metaplasias and carcinomas. Expressi
Target Research Area
Others
Target Synonyms
KRT2; KRT2A; KRT2E; Keratin; type II cytoskeletal 2 epidermal; Cytokeratin-2e; CK-2e; Epithelial keratin-2e; Keratin-2 epidermis; Keratin-2e; K2e; Type-II keratin Kb2
Target Background
The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is expressed largely in the upper spinous layer of epidermal keratinocytes and mutations in this gene have been associated with bullous congenital ichthyosiform erythroderma. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.
Notification