-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DHFR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 88-187 of human DHFR (NP_000782.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DHFR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 88-187 of human DHFR (NP_000782.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14038A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DHFR |
| Target Synonyms | DYR; DHFR1; DHFRP1; DHFR | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, C2C12, Hep G2, Mouse liver, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 88-187 of human DHFR (NP_000782.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND | Uniprot ID | P00374 |
Uniprot Id
P00374
Target Species
Human
Target Name
DHFR
Target Full Name
Dihydrofolate reductase
Target Function
Key enzyme in folate metabolism. Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis. Binds its own mRNA and that of DHFR2.
Target Involvement
Megaloblastic anemia due to dihydrofolate reductase deficiency (DHFRD)
Target Subcellular Location
Mitochondrion. Cytoplasm.
Target Protein Families
Dihydrofolate reductase family
Target Tissue Specificity
Widely expressed in fetal and adult tissues, including throughout the fetal and adult brains and whole blood. Expression is higher in the adult brain than in the fetal brain.
Target Research Area
Cell Biology, Signal Transduction
Target Synonyms
DHFR; DHFRP1; Dihydrofolate reductase; DYR; DYR_HUMAN; EC 1.5.1.3
Target Background
Dihydrofolate reductase converts dihydrofolate into tetrahydrofolate, a methyl group shuttle required for the de novo synthesis of purines, thymidylic acid, and certain amino acids. While the functional dihydrofolate reductase gene has been mapped to chromosome 5, multiple intronless processed pseudogenes or dihydrofolate reductase-like genes have been identified on separate chromosomes. Dihydrofolate reductase deficiency has been linked to megaloblastic anemia. Several transcript variants encoding different isoforms have been found for this gene.
Notification