-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DNA Polymerase beta was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 236-335 of human DNA Polymerase beta (P06746) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against DNA Polymerase beta was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 236-335 of human DNA Polymerase beta (P06746) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13789A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DNA Polymerase beta |
| Target Synonyms | POLB; DNA polymerase beta; DNA Polymerase beta | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-431, Jurkat, Mouse spleen, Mouse testis, Mouse thymus, Rat spleen, Rat testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 236-335 of human DNA Polymerase beta (P06746). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE | Uniprot ID | P06746 |
Uniprot Id
P06746
Target Species
Human
Target Name
POLB
Target Full Name
DNA polymerase beta
Target Function
Repair polymerase that plays a key role in base-excision repair. Has 5'-deoxyribose-5-phosphate lyase (dRP lyase) activity that removes the 5' sugar phosphate and also acts as a DNA polymerase that adds one nucleotide to the 3' end of the arising single-nucleotide gap. Conducts 'gap-filling' DNA synthesis in a stepwise distributive fashion rather than in a processive fashion as for other DNA polymerases.
Target Subcellular Location
Nucleus. Cytoplasm. Note=Cytoplasmic in normal conditions. Translocates to the nucleus following DNA damage.
Target Protein Families
DNA polymerase type-X family
Target Synonyms
DNA directed DNA polymerase beta; DNA pol beta; DNA polymerase beta; DNA polymerase beta subunit; DPOLB_HUMAN; MGC125976; Pol B; Pol beta; POLB; Polymerase (DNA directed) beta
Target Background
The protein encoded by this gene is a DNA polymerase involved in base excision and repair, also called gap-filling DNA synthesis. The encoded protein, acting as a monomer, is normally found in the cytoplasm, but it translocates to the nucleus upon DNA damage. Several transcript variants of this gene exist, but the full-length nature of only one has been described to date.
Notification