-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DNMT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNMT1 (NP_001370.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against DNMT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNMT1 (NP_001370.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-16759A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DNMT1 |
| Target Synonyms | AIM; DNMT; MCMT; CXXC9; HSN1E; ADCADN; m.HsaI; [KD Validated] DNMT1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Jurkat | Application | ELISA, WB, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNMT1 (NP_001370.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYN | Uniprot ID | P26358 |
Uniprot Id
P26358
Target Species
Human
Target Name
DNMT1
Target Full Name
DNA (cytosine-5)-methyltransferase 1
Target Function
Methylates CpG residues. Preferentially methylates hemimethylated DNA. Associates with DNA replication sites in S phase maintaining the methylation pattern in the newly synthesized strand, that is essential for epigenetic inheritance. Associates with chromatin during G2 and M phases to maintain DNA methylation independently of replication. It is responsible for maintaining methylation patterns established in development. DNA methylation is coordinated with methylation of histones. Mediates transcriptional repression by direct binding to HDAC2. In association with DNMT3B and via the recruitment of CTCFL/BORIS, involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9. Probably forms a corepressor complex required for activated KRAS-mediated promoter hypermethylation and transcriptional silencing of tumor suppressor genes (TSGs) or other tumor-related genes in colorectal cancer (CRC) cells. Also required to maintain a transcriptionally repressive state of genes in undifferentiated embryonic stem cells (ESCs). Associates at promoter regions of tumor suppressor genes (TSGs) leading to their gene silencing. Promotes tumor growth.
Target Involvement
Neuropathy, hereditary sensory, 1E (HSN1E); Cerebellar ataxia, deafness, and narcolepsy, autosomal dominant (ADCADN)
Target Subcellular Location
Nucleus.
Target Protein Families
Class I-like SAM-binding methyltransferase superfamily, C5-methyltransferase family
Target Tissue Specificity
Ubiquitous; highly expressed in fetal tissues, heart, kidney, placenta, peripheral blood mononuclear cells, and expressed at lower levels in spleen, lung, brain, small intestine, colon, liver, and skeletal muscle. Isoform 2 is less expressed than isoform
Target Synonyms
ADCADN; AIM; CXXC finger protein 9; CXXC-type zinc finger protein 9; CXXC9; DNA (cytosine 5 ) methyltransferase 1; DNA (cytosine-5)-methyltransferase 1; DNA methyltransferase 1; DNA methyltransferase HsaI; DNA methyltransferase M.HsaI.; DNA MTase; DNA MTase HsaI; DNMT 1; DNMT; Dnmt1; DNMT1_HUMAN; Dnmt1o; FLJ16293; HSN1E; M.HsaI; MCMT; Met1; MGC104992; mMmul; MommeD2
Target Background
This gene encodes an enzyme that transfers methyl groups to cytosine nucleotides of genomic DNA. This protein is the major enzyme responsible for maintaining methylation patterns following DNA replication and shows a preference for hemi-methylated DNA. Methylation of DNA is an important component of mammalian epigenetic gene regulation. Aberrant methylation patterns are found in human tumors and associated with developmental abnormalities. Variation in this gene has been associated with cerebellar ataxia, deafness, and narcolepsy, and neuropathy, hereditary sensory, type IE. Alternative splicing results in multiple transcript variants.
Notification