Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Dynamin 3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human Dynamin 3 (Q9UQ16) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Dynamin 3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human Dynamin 3 (Q9UQ16) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13513A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Dynamin 3 |
| Target Synonyms | Dyna III; Dynamin 3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse spinal cord, Mouse testis, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 700-800 of human Dynamin 3 (Q9UQ16). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ELLAQLYSSEDQNTLMEESAEQAQRRDEMLRMYQALKEALGIIGDISTATVSTPAPPPVDDSWIQHSRRSPPPSPTTQRRPTLSAPLARPTSGRGPAPAIP | Uniprot ID | Q9UQ16 |
Uniprot Id
Q9UQ16
Target Species
Human
Target Name
DNM3
Target Full Name
Dynamin-3
Target Function
Microtubule-associated force-producing protein involved in producing microtubule bundles and able to bind and hydrolyze GTP. Most probably involved in vesicular trafficking processes, in particular endocytosis.
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton.
Target Protein Families
TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family
Target Synonyms
testicular dynamin; testicular; DNM 3; DNM3; DNM3 protein; Dyn3; DYN3_HUMAN; Dyna III; DynaIII; dynamin 2 ; Dynamin; Dynamin family member; Dynamin testicular; Dynamin-3; Dynamin3; EC 3.6.5.5; KIAA0820; MGC70433; T dynamin; T-dynamin
Target Background
This gene encodes a member of a family of guanosine triphosphate (GTP)-binding proteins that associate with microtubules and are involved in vesicular transport. The encoded protein functions in the development of megakaryocytes. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
