-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Dystrophin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 3586-3685 of human Dystrophin (P11532) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
The antibody against Dystrophin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 3586-3685 of human Dystrophin (P11532) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13527A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Dystrophin |
| Target Synonyms | BMD; CMD3B; MRX85; DXS142; DXS164; DXS206; DXS230; DXS239; DXS268; DXS269; DXS270; DXS272; Dystrophin | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 3586-3685 of human Dystrophin (P11532). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LESQLHRLRQLLEQPQAEAKVNGTTVSSPSTSLQRSDSSQPMLLRVVGSQTSDSMGEEDLLSPPQDTSTGLEEVMEQLNNSFPSSRGRNTPGKPMREDTM | Uniprot ID | P11532 |
Uniprot Id
P11532
Target Species
Human
Target Name
DMD
Target Full Name
Dystrophin
Target Function
Anchors the extracellular matrix to the cytoskeleton via F-actin. Ligand for dystroglycan. Component of the dystrophin-associated glycoprotein complex which accumulates at the neuromuscular junction (NMJ) and at a variety of synapses in the peripheral and central nervous systems and has a structural function in stabilizing the sarcolemma. Also implicated in signaling events and synaptic transmission.
Target Involvement
Duchenne muscular dystrophy (DMD); Becker muscular dystrophy (BMD); Cardiomyopathy, dilated, X-linked 3B (CMD3B)
Target Subcellular Location
Cell membrane, sarcolemma; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton. Cell junction, synapse, postsynaptic cell membrane.
Target Tissue Specificity
Expressed in muscle fibers accumulating in the costameres of myoplasm at the sarcolemma. Expressed in brain, muscle, kidney, lung and testis. Most tissues contain transcripts of multiple isoforms. Isoform 15: Only isoform to be detected in heart and liver
Target Synonyms
BMD; CMD3B; DMD; DMD_HUMAN; Duchenne muscular dystrophy protein; Dystrophin; Muscular dystrophy Duchenne and Becker types
Target Background
This gene spans a genomic range of greater than 2 Mb and encodes a large protein containing an N-terminal actin-binding domain and multiple spectrin repeats. The encoded protein forms a component of the dystrophin-glycoprotein complex (DGC), which bridges the inner cytoskeleton and the extracellular matrix. Deletions, duplications, and point mutations at this gene locus may cause Duchenne muscular dystrophy (DMD), Becker muscular dystrophy (BMD), or cardiomyopathy. Alternative promoter usage and alternative splicing result in numerous distinct transcript variants and protein isoforms for this gene.
Notification