-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EB3/MAPRE3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 182-281 of human EB3/MAPRE3 (Q9UPY8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against EB3/MAPRE3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 182-281 of human EB3/MAPRE3 (Q9UPY8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14286A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EB3/MAPRE3 |
| Target Synonyms | EB3; RP3; EBF3; EBF3-S; EB3/MAPRE3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 182-281 of human EB3/MAPRE3 (Q9UPY8). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY | Uniprot ID | Q9UPY8 |
Uniprot Id
Q9UPY8
Target Species
Human
Target Name
MAPRE3
Target Full Name
Microtubule-associated protein RP/EB family member 3
Target Function
Plus-end tracking protein (+TIP) that binds to the plus-end of microtubules and regulates the dynamics of the microtubule cytoskeleton. Promotes microtubule growth. May be involved in spindle function by stabilizing microtubules and anchoring them at centrosomes. Also acts as a regulator of minus-end microtubule organization: interacts with the complex formed by AKAP9 and PDE4DIP, leading to recruit CAMSAP2 to the Golgi apparatus, thereby tethering non-centrosomal minus-end microtubules to the Golgi, an important step for polarized cell movement. Promotes elongation of CAMSAP2-decorated microtubule stretches on the minus-end of microtubules. May play a role in cell migration.
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
MAPRE family
Target Tissue Specificity
Predominantly expressed in brain and muscle.
Target Synonyms
APC binding protein ; EB 3; EB1 protein family member 3; EB3; EBF 3; EBF-3; EBF3; EBF3 S; End binding protein 3 ; End-binding protein 3; MAPRE 3; MAPRE3; MARE3_HUMAN; Member 3; Microtubule Associated Protein; Microtubule associated protein RP/EB family member 3; Microtubule-associated protein RP/EB family member 3; OTTHUMP00000200910; RP 3; RP/EB Family; RP3
Target Background
The protein encoded by this gene is a member of the RP/EB family of genes. The protein localizes to the cytoplasmic microtubule network and binds APCL, a homolog of the adenomatous polyposis coli tumor suppressor gene.
Notification