-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against eEF1A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human eEF1A1 (NP_001393.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against eEF1A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human eEF1A1 (NP_001393.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13773A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EEF1A1 |
| Target Synonyms | CCS3; EF1A; PTI1; CCS-3; EE1A1; EEF-1; EEF1A; EF-Tu; EF1A1; LENG7; eEF1A-1; GRAF-1EF; EF1alpha1; eEF1A1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, 293T, MCF7, Mouse liver, Mouse lung, Rat kidney | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human eEF1A1 (NP_001393.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHP | Uniprot ID | P68104 |
Uniprot Id
P68104
Target Species
Human
Target Name
EEF1A1
Target Full Name
Elongation factor 1-alpha 1
Target Function
This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis. Plays a role in the positive regulation of IFNG transcription in T-helper 1 cells as part of an IFNG promoter-binding complex with TXK and PARP1.; (Microbial infection) Required for the translation of viral proteins and viral replication during human coronavirus SARS-CoV-2 infection.
Target Subcellular Location
Cytoplasm. Nucleus. Nucleus, nucleolus. Cell membrane.
Target Protein Families
TRAFAC class translation factor GTPase superfamily, Classic translation factor GTPase family, EF-Tu/EF-1A subfamily
Target Tissue Specificity
Brain, placenta, lung, liver, kidney, pancreas but barely detectable in heart and skeletal muscle.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
CCS 3; CCS3; Cervical cancer suppressor 3; chunp6927; CTCL tumor antigen; EE1A1; EEF 1; EEF1A; eEF1A-1; EEF1A1; EF-1-alpha-1; EF-Tu; EF1A; EF1a like protein; EF1A1_HUMAN; Elongation factor 1 alpha subunit; Elongation factor 1-alpha 1; Elongation factor Tu; Eukaryotic elongation factor 1 A-1; Eukaryotic translation elongation factor 1 alpha 1; Eukaryotic translation elongation factor 1 alpha 1 like 14; Glucocorticoid receptor AF 1 specific elongation factor; GRAF 1EF; HNGC:16303; ik:tdsubc_2a3; ik:tdsubc_2b3; LENG7; Leukocyte receptor cluster (LRC) member 7; Leukocyte receptor cluster member 7; Prostate tumor inducing protein 1; PTI1; tdsubc_2a3; Translation elongation factor 1 alpha 1 like 14; wu:fa91c07; wu:fa94b03; wu:fi13b09; xx:tdsubc_2a3; xx:tdsubc_2b3
Target Background
This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes.
Notification