-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EpCAM was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 215-314 of human EpCAM (P16422) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against EpCAM was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 215-314 of human EpCAM (P16422) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16990A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EPCAM |
| Target Synonyms | ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; BerEp4; EGP314; HNPCC8; LYNCH8; MOC-31; Ber-Ep4; TACSTD1; EpCAM | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 215-314 of human EpCAM (P16422). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA | Uniprot ID | P16422 |
Uniprot Id
P16422
Target Species
Human
Target Name
EPCAM
Target Full Name
Epithelial cell adhesion molecule
Target Function
May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.
Target Involvement
Diarrhea 5, with tufting enteropathy, congenital (DIAR5); Hereditary non-polyposis colorectal cancer 8 (HNPCC8)
Target Subcellular Location
Lateral cell membrane; Single-pass type I membrane protein. Cell junction, tight junction.
Target Protein Families
EPCAM family
Target Tissue Specificity
Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal
Target Research Area
Tags & Cell Markers
Target Synonyms
17 1A; 323/A3; Adenocarcinoma associated antigen; Adenocarcinoma-associated antigen; Antigen identified by monoclonal AUA1; AUA1; CD326; CD326 antigen; Cell surface glycoprotein Trop 1; Cell surface glycoprotein Trop 2; Cell surface glycoprotein Trop-1; CO 17A; CO17 1A; CO17A; DIAR5; EGP 2; EGP; EGP2; EGP314; EGP40; Ep CAM; Ep-CAM; EPCAM; EPCAM_HUMAN; EpCAM1; Epithelial cell adhesion molecule; Epithelial Cell Adhesion Molecule Intracellular Domain (EpCAM-ICD); Epithelial cell surface antigen; Epithelial cellular adhesion molecule; Epithelial glycoprotein 1; Epithelial glycoprotein 314; Epithelial glycoprotein; ESA; GA733 1; GA733 2; GA733-2; gastrointestinal tumor-associated antigen 2; 35-KD glycoprotein; gp4; hEGP 2; hEGP314; HNPCC8; Human epithelial glycoprotein 2; KS 1/4 antigen; KS1/4; KSA; Ly74; Lymphocyte antigen 74; M1S 1; M1S2; M4S1; Major gastrointestinal tumor associated protein GA733 2; Major gastrointestinal tumor-associated protein GA733-2; mEGP314; Membrane component chromosome 4 surface marker (35kD glycoprotein); Membrane component; chromosome 4; surface marker 1; Membrane component; chromosome 4; surface marker; MIC18; MK 1; Protein 289A; TACD1; TACSTD1; TROP1; Tumor associated calcium signal transducer 1; Tumor associated calcium signal transducer 2 precursor; Tumor-associated calcium signal transducer 1
Target Background
This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.
Notification