-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Filamin A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2548-2647 of human Filamin A (P21333) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Filamin A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2548-2647 of human Filamin A (P21333) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16590A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Filamin A |
| Target Synonyms | FLN; FMD; MNS; OPD; ABPX; CSBS; CVD1; FGS2; FLN1; NHBP; OPD1; OPD2; XLVD; XMVD; FLN-A; ABP-280; Filamin A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse lung, U-937 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 2548-2647 of human Filamin A (P21333). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVVP | Uniprot ID | P21333 |
Uniprot Id
P21333
Target Species
Human
Target Name
FLNA
Target Full Name
Filamin-A
Target Function
Promotes orthogonal branching of actin filaments and links actin filaments to membrane glycoproteins. Anchors various transmembrane proteins to the actin cytoskeleton and serves as a scaffold for a wide range of cytoplasmic signaling proteins. Interaction with FLNB may allow neuroblast migration from the ventricular zone into the cortical plate. Tethers cell surface-localized furin, modulates its rate of internalization and directs its intracellular trafficking. Involved in ciliogenesis. Plays a role in cell-cell contacts and adherens junctions during the development of blood vessels, heart and brain organs. Plays a role in platelets morphology through interaction with SYK that regulates ITAM- and ITAM-like-containing receptor signaling, resulting in by platelet cytoskeleton organization maintenance. During the axon guidance process, required for growth cone collapse induced by SEMA3A-mediated stimulation of neurons.
Target Involvement
Periventricular nodular heterotopia 1 (PVNH1); Otopalatodigital syndrome 1 (OPD1); Otopalatodigital syndrome 2 (OPD2); Frontometaphyseal dysplasia 1 (FMD1); Melnick-Needles syndrome (MNS); Intestinal pseudoobstruction, neuronal, chronic idiopathic, X-linked (IPOX); FG syndrome 2 (FGS2); Terminal osseous dysplasia (TOD); Cardiac valvular dysplasia X-linked (CVDX); Congenital short bowel syndrome, X-linked (CSBSX)
Target Subcellular Location
Cytoplasm, cell cortex. Cytoplasm, cytoskeleton. Perikaryon. Cell projection, growth cone.
Target Protein Families
Filamin family
Target Tissue Specificity
Ubiquitous.
Target Research Area
Signal Transduction
Target Synonyms
ABP 280 ; ABP-280; Actin-binding protein 280; Alpha filamin; Alpha-filamin; APBX; CSBS; CVD1; Endothelial actin binding protein; Endothelial actin-binding protein; Filamin 1; Filamin A alpha; Filamin A; Filamin-1; Filamin-A; FLN; FLN-A; FLN1; FLNA; FLNA_HUMAN; FMD; MNS; NHBP; Non muscle filamin ; Non-muscle filamin; OPD; OPD1; OPD2; XLVD; XMVD
Target Background
The protein encoded by this gene is an actin-binding protein that crosslinks actin filaments and links actin filaments to membrane glycoproteins. The encoded protein is involved in remodeling the cytoskeleton to effect changes in cell shape and migration. This protein interacts with integrins, transmembrane receptor complexes, and second messengers. Defects in this gene are a cause of several syndromes, including periventricular nodular heterotopias (PVNH1, PVNH4), otopalatodigital syndromes (OPD1, OPD2), frontometaphyseal dysplasia (FMD), Melnick-Needles syndrome (MNS), and X-linked congenital idiopathic intestinal pseudoobstruction (CIIPX). Two transcript variants encoding different isoforms have been found for this gene.
Notification