-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GNA13 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 278-377 of human GNA13 (Q14344) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GNA13 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 278-377 of human GNA13 (Q14344) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13315A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNA13 |
| Target Synonyms | G13; HG1N; GNA13 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, U2OS | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 278-377 of human GNA13 (Q14344). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NRVFSNVSIILFLNKTDLLEEKVQIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLMLQ | Uniprot ID | Q14344 |
Uniprot Id
Q14344
Target Species
Human
Target Name
GNA13
Target Full Name
Guanine nucleotide-binding protein subunit alpha-13
Target Function
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Activates effector molecule RhoA by binding and activating RhoGEFs (ARHGEF1/p115RhoGEF, ARHGEF11/PDZ-RhoGEF and ARHGEF12/LARG). GNA13-dependent Rho signaling subsequently regulates transcription factor AP-1 (activating protein-1). Promotes tumor cell invasion and metastasis by activating RhoA/ROCK signaling pathway. Inhibits CDH1-mediated cell adhesion in process independent from Rho activation.
Target Subcellular Location
Cell membrane; Lipid-anchor. Melanosome. Cytoplasm. Nucleus.
Target Protein Families
G-alpha family, G(12) subfamily
Target Tissue Specificity
Expressed in testis, including in Leydig cells and in the seminiferous epithelium, in differentiating cells from the spermatogonia to mature spermatozoa stages and round spermatids (at protein level). Expressed in 99.2% of spermatozoa from healthy individ
Target Research Area
Signal Transduction
Target Synonyms
G alpha 13; G alpha-13; G-protein subunit alpha-13; GNA13; GNA13_HUMAN; Guanine nucleotide binding protein (G protein) alpha 13; Guanine nucleotide binding protein alpha 13 subunit; Guanine nucleotide-binding protein subunit alpha-13
Target Background
Predicted to enable D5 dopamine receptor binding activity; G-protein beta/gamma-subunit complex binding activity; and GTPase activity. Predicted to be involved in several processes, including Rho protein signal transduction; activation of phospholipase D activity; and multicellular organism aging. Predicted to act upstream of or within several processes, including branching involved in blood vessel morphogenesis; negative regulation of vascular associated smooth muscle cell migration; and negative regulation of vascular associated smooth muscle cell proliferation. Located in cytosol and nucleus.
Notification