-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GNE was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 623-722 of human GNE (Q9Y223) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GNE was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 623-722 of human GNE (Q9Y223) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13293A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNE |
| Target Synonyms | NM; DMRV; IBM2; Uae1; GLCNE; GNE | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HepG2, Jurkat, K-562, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 623-722 of human GNE (Q9Y223). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GALHLIQAAKLGNAKAQSILRTAGTALGLGVVNILHTMNPSLVILSGVLASHYIHIVKDVIRQQALSSVQDVDVVVSDLVDPALLGAASMVLDYTTRRIY | Uniprot ID | Q9Y223 |
Uniprot Id
Q9Y223
Target Species
Human
Target Name
GNE
Target Full Name
Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase
Target Function
Regulates and initiates biosynthesis of N-acetylneuraminic acid (NeuAc), a precursor of sialic acids. Plays an essential role in early development. Required for normal sialylation in hematopoietic cells. Sialylation is implicated in cell adhesion, signal transduction, tumorigenicity and metastatic behavior of malignant cells.
Target Involvement
Sialuria (SIALURIA); Nonaka myopathy (NM)
Target Subcellular Location
Cytoplasm.
Target Protein Families
UDP-N-acetylglucosamine 2-epimerase family; ROK (NagC/XylR) family
Target Tissue Specificity
Highest expression in liver and placenta. Also found in heart, brain, lung, kidney, skeletal muscle and pancreas. Isoform 1 is expressed in heart, brain, kidney, liver, placenta, lung, spleen, pancreas, skeletal muscle and colon. Isoform 2 is expressed ma
Target Research Area
Cardiovascular
Target Synonyms
2310066H07Rik; Bifunctional UDP N acetylglucosamine 2 epimerase/N acetylmannosamine kinase; DMRV; GLCNE_HUMAN; Glucosamine (UDP N acetyl) 2 epimerase/N acetylmannosamine kinase; GNE; IBM2; ManAc kinase; N acylmannosamine kinase; N-acetylmannosamine kinase; NM; RP23-209M8.6; Uae1; UDP GlcNAc 2 epimerase; UDP GlcNAc 2 epimerase/ManAc kinase; UDP N acetylglucosamine 2 epimerase/N acetylmannosamine kinase; UDP-GlcNAc-2-epimerase; UDP-GlcNAc-2-epimerase/ManAc kinase; Uridine diphosphate N acetylglucosamine 2 epimerase; Uridine diphosphate-N-acetylglucosamine-2-epimerase
Target Background
The protein encoded by this gene is a bifunctional enzyme that initiates and regulates the biosynthesis of N-acetylneuraminic acid (NeuAc), a precursor of sialic acids. It is a rate-limiting enzyme in the sialic acid biosynthetic pathway. Sialic acid modification of cell surface molecules is crucial for their function in many biologic processes, including cell adhesion and signal transduction. Differential sialylation of cell surface molecules is also implicated in the tumorigenicity and metastatic behavior of malignant cells. Mutations in this gene are associated with sialuria, autosomal recessive inclusion body myopathy, and Nonaka myopathy. Alternative splicing of this gene results in transcript variants encoding different isoforms.
Notification