-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Granulin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human Granulin (P28799) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Granulin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human Granulin (P28799) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14670A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Granulin |
| Target Synonyms | GEP; GP88; PEPI; PGRN; CLN11; PCDGF; Granulin | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human Granulin (P28799). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MWTLVSWVALTAGLVAGTRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCC | Uniprot ID | P28799 |
Uniprot Id
P28799
Target Species
Human
Target Name
GRN
Target Full Name
Progranulin
Target Function
Secreted protein that acts as a key regulator of lysosomal function and as a growth factor involved in inflammation, wound healing and cell proliferation. Regulates protein trafficking to lysosomes and, also the activity of lysosomal enzymes. Facilitates also the acidification of lysosomes, causing degradation of mature CTSD by CTSB. In addition, functions as wound-related growth factor that acts directly on dermal fibroblasts and endothelial cells to promote division, migration and the formation of capillary-like tubule structures. Also promotes epithelial cell proliferation by blocking TNF-mediated neutrophil activation preventing release of oxidants and proteases. Moreover, modulates inflammation in neurons by preserving neurons survival, axonal outgrowth and neuronal integrity.; Promotes proliferation of the epithelial cell line A431 in culture.; Inhibits epithelial cell proliferation and induces epithelial cells to secrete IL-8.; Stabilizes CTSD through interaction with CTSD leading to maintain its aspartic-type peptidase activity.
Target Involvement
Ubiquitin-positive frontotemporal dementia (UP-FTD); Ceroid lipofuscinosis, neuronal, 11 (CLN11)
Target Subcellular Location
Secreted. Lysosome.
Target Protein Families
Granulin family
Target Tissue Specificity
In myelogenous leukemic cell lines of promonocytic, promyelocytic, and proerythroid lineage, in fibroblasts, and very strongly in epithelial cell lines. Present in inflammatory cells and bone marrow. Highest levels in kidney.
Target Synonyms
Acrogranin; CLN11; GEP; GP88; Granulin A; Granulin B; Granulin C; Granulin D; Granulin E; Granulin epithelin; Granulin F; Granulin G; Granulin-7; Granulins; GRN; GRN_HUMAN; PC cell derived growth factor; PCDGF; PEPI; PGRN; Proepithelin; Progranulin
Target Background
Granulins are a family of secreted, glycosylated peptides that are cleaved from a single precursor protein with 7.5 repeats of a highly conserved 12-cysteine granulin/epithelin motif. The 88 kDa precursor protein, progranulin, is also called proepithelin and PC cell-derived growth factor. Cleavage of the signal peptide produces mature granulin which can be further cleaved into a variety of active, 6 kDa peptides. These smaller cleavage products are named granulin A, granulin B, granulin C, etc. Epithelins 1 and 2 are synonymous with granulins A and B, respectively. Both the peptides and intact granulin protein regulate cell growth. However, different members of the granulin protein family may act as inhibitors, stimulators, or have dual actions on cell growth. Granulin family members are important in normal development, wound healing, and tumorigenesis.
Notification