-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HIF1AN/FIH1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HIF1AN/FIH1 (Q9NWT6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HIF1AN/FIH1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HIF1AN/FIH1 (Q9NWT6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-17167A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HIF1AN/FIH1 |
| Target Synonyms | FIH1; H1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HIF1AN/FIH1 (Q9NWT6). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKF | Uniprot ID | Q9NWT6 |
Uniprot Id
Q9NWT6
Target Species
Human
Target Name
HIF1AN
Target Full Name
Hypoxia-inducible factor 1-alpha inhibitor
Target Function
Hydroxylates HIF-1 alpha at 'Asn-803' in the C-terminal transactivation domain (CAD). Functions as an oxygen sensor and, under normoxic conditions, the hydroxylation prevents interaction of HIF-1 with transcriptional coactivators including Cbp/p300-interacting transactivator. Involved in transcriptional repression through interaction with HIF1A, VHL and histone deacetylases. Hydroxylates specific Asn residues within ankyrin repeat domains (ARD) of NFKB1, NFKBIA, NOTCH1, ASB4, PPP1R12A and several other ARD-containing proteins. Also hydroxylates Asp and His residues within ARDs of ANK1 and TNKS2, respectively. Negatively regulates NOTCH1 activity, accelerating myogenic differentiation. Positively regulates ASB4 activity, promoting vascular differentiation.
Target Subcellular Location
Nucleus. Cytoplasm. Cytoplasm, perinuclear region. Note=Mainly cytoplasmic localization, but interaction with NOTCH1 results in nuclear localization and interaction with ABPA3 results in perinuclear localization in macrophages.
Target Research Area
Cancer
Target Synonyms
DKFZp762F1811; Factor inhibiting HIF-1; Factor inhibiting HIF1 ; FIH 1; FIH-1; FIH1; FLJ20615; FLJ22027 ; HIF1AN; HIF1N_HUMAN; Hypoxia inducible factor 1 alpha inhibitor; Hypoxia inducible factor 1 alpha subunit inhibitor; Hypoxia inducible factor asparagine hydroxylase; Hypoxia-inducible factor 1-alpha inhibitor; Hypoxia-inducible factor asparagine hydroxylase; Peptide aspartate beta dioxygenase
Target Background
Enables several functions, including 2-oxoglutarate-dependent dioxygenase activity; NF-kappaB binding activity; and transition metal ion binding activity. Involved in several processes, including negative regulation of Notch signaling pathway; negative regulation of transcription from RNA polymerase II promoter in response to hypoxia; and protein hydroxylation. Located in cytosol; nucleoplasm; and perinuclear region of cytoplasm. Colocalizes with nucleus.
Notification