-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against hnRNP E1/PCBP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PCBP1 (Q15365) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against hnRNP E1/PCBP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PCBP1 (Q15365) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14349A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | hnRNP E1/PCBP1 |
| Target Synonyms | HNRPX; HNRPE1; hnRNP-X; HEL-S-85; hnRNP-E1; hnRNP E1/PCBP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-431, HepG2, K-562, Mouse brain, Mouse lung, Rat pancreas | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PCBP1 (Q15365). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTL | Uniprot ID | Q15365 |
Uniprot Id
Q15365
Target Species
Human
Target Name
PCBP1
Target Full Name
Poly(rC)-binding protein 1
Target Function
Single-stranded nucleic acid binding protein that binds preferentially to oligo dC. In case of infection by poliovirus, plays a role in initiation of viral RNA replication in concert with the viral protein 3CD.
Target Subcellular Location
Nucleus. Cytoplasm. Note=Loosely bound in the nucleus. May shuttle between the nucleus and the cytoplasm.
Target Tissue Specificity
Abundantly expressed in skeletal muscle, thymus and peripheral blood leukocytes while a lower expression is observed in prostate, spleen, testis, ovary, small intestine, heart, liver, adrenal and thyroid glands.
Target Synonyms
Alpha-CP1; Heterogeneous nuclear ribonucleoprotein E1; heterogenous nuclear ribonucleoprotein E1; heterogenous nuclear ribonucleoprotein X; hnRNP E1; hnRNP-E1 ; hnRNP-X ; HNRPE1; HNRPX; nucleic acid binding protein sub 2.3; Nucleic acid- binding protein SUB2.3; Nucleic acid-binding protein SUB2.3; PCBP1; PCBP1_HUMAN; poly(rC) binding protein 1; Poly(rC)-binding protein 1; rCbinding protein 1
Target Background
This intronless gene is thought to have been generated by retrotransposition of a fully processed PCBP-2 mRNA. This gene and PCBP-2 have paralogues (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. The protein encoded by this gene appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in RNA binding. This encoded protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability.
Notification