-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HP1 alpha/CBX5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 92-191 of human HP1 alpha/CBX5 (P45973) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against HP1 alpha/CBX5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 92-191 of human HP1 alpha/CBX5 (P45973) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-16041A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HP1 alpha/CBX5 |
| Target Synonyms | HP1; HP1A; HEL25; HP1 alpha/CBX5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, MCF7, Mouse brain, Mouse lung, Rat lung | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 92-191 of human HP1 alpha/CBX5 (P45973). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS | Uniprot ID | P45973 |
Uniprot Id
P45973
Target Species
Human
Target Name
CBX5
Target Full Name
Chromobox protein homolog 5
Target Function
Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph). Can interact with lamin-B receptor (LBR). This interaction can contribute to the association of the heterochromatin with the inner nuclear membrane. Involved in the formation of functional kinetochore through interaction with MIS12 complex proteins.
Target Subcellular Location
Nucleus. Chromosome. Chromosome, centromere.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Antigen p25; CBX5; CBX5_HUMAN; CG8409; Chromobox 5; Chromobox homolog 5 (HP1 alpha homolog; Drosophila); Chromobox homolog 5; Chromobox protein homolog 5; Epididymis luminal protein 25; HEL25; Heterochromatin protein 1 alpha; Heterochromatin protein 1; Heterochromatin protein 1 homolog alpha; HP1 alpha; HP1 alpha homolog; HP1; HP1A; HP1Hs alpha; Su(var)205
Target Background
This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The encoded product is involved in the formation of functional kinetochore through interaction with essential kinetochore proteins. The gene has a pseudogene located on chromosome 3. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Notification