-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HSPB8/HSP22 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HSPB8/HSP22 (Q9UJY1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against HSPB8/HSP22 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HSPB8/HSP22 (Q9UJY1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13783A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HSPB8/HSP22 |
| Target Synonyms | H11; HMN2; CMT2L; DHMN2; E2IG1; HMN2A; HSP22; CRYAC; HSPB8/HSP22 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HSPB8/HSP22 (Q9UJY1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCV | Uniprot ID | Q9UJY1 |
Uniprot Id
Q9UJY1
Target Species
Human
Target Name
HSPB8
Target Full Name
Heat shock protein beta-8
Target Function
Displays temperature-dependent chaperone activity.
Target Involvement
Neuronopathy, distal hereditary motor, 2A (HMN2A); Charcot-Marie-Tooth disease 2L (CMT2L)
Target Subcellular Location
Cytoplasm. Nucleus. Note=Translocates to nuclear foci during heat shock.
Target Protein Families
Small heat shock protein (HSP20) family
Target Tissue Specificity
Predominantly expressed in skeletal muscle and heart.
Target Synonyms
Alpha crystallin C chain; Alpha-crystallin C chain; Charcot Marie Tooth disease axonal type 2L; Charcot Marie Tooth disease spinal; CMT2L; CRYAC; DHMN 2; DHMN2; E2 induced gene 1 protein; E2-induced gene 1 protein; E2IG1; H11; Heat shock 22kDa protein 8; Heat shock 27kDa protein 8; Heat shock protein 22; Heat shock protein beta 8; Heat shock protein beta-8; Hereditary motor neuropathy distal; HMN 2; HMN2; HMN2A; HSB8; HSPB 8; HspB8; HSPB8_HUMAN; OTTHUMP00000239768; Protein kinase H11; Small stress protein like protein HSP22; Small stress protein-like protein HSP22; Spinal muscular atrophy distal adult autosomal dominant
Target Background
The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease.
Notification