Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Human Lambda Light Chain was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human Lambda Light Chain as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Human Lambda Light Chain was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human Lambda Light Chain as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
Western blot analysis of various lysates, using Human Lambda Light Chain Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Negative control (NC): HAP1
Exposure time: 0.2s.
| Cat.No | ADA-15537A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Human Lambda Light Chain |
| Form | Liquid | Species Reactivity | Human, Rat |
| Isotype | IgG | Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. |
| Purification Method | Affinity purification | Positive Samples | Human plasma, Rat plasma |
| Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human Lambda Light Chain. | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS | Uniprot ID | P0CG04 |
Uniprot Id
P0CG04
Target Species
Human
Target Name
IGLC1
Target Full Name
Immunoglobulin lambda constant 1
Target Function
Constant region of immunoglobulin light chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens. The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen
Target Subcellular Location
Secreted. Cell membrane.
Target Research Area
Immunology
Target Synonyms
IGLC1Immunoglobulin lambda constant 1; Ig lambda chain C region MGC; Ig lambda-1 chain C region
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
