Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against JunB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human JunB (P17275) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against JunB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human JunB (P17275) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16606A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | JUNB |
| Target Synonyms | AP-1; JunB | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human JunB (P17275). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVIT | Uniprot ID | P17275 |
Uniprot Id
P17275
Target Species
Human
Target Name
JUNB
Target Full Name
Transcription factor JunB
Target Function
Transcription factor involved in regulating gene activity following the primary growth factor response. Binds to the DNA sequence 5'-TGA[CG]TCA-3'.
Target Subcellular Location
Nucleus.
Target Protein Families
BZIP family, Jun subfamily
Target Synonyms
Activator protein 1; AP 1 ; AP1 ; Jun B; Jun B proto oncogene; Jun B protooncogene; Junb; JunB proto oncogene; JunB protoncogene 9; JunB protooncogene; JUNB_HUMAN; Transcription factor jun B; Transcription factor jun-B; Transcription factor junB
Target Background
Enables sequence-specific double-stranded DNA binding activity. Involved in positive regulation of transcription by RNA polymerase II. Located in nucleoplasm. Part of transcription factor AP-1 complex. Biomarker of Hodgkin's lymphoma and anaplastic large cell lymphoma.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
