-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Kininogen 1 (KNG1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 545-644 of human Kininogen 1 (KNG1) (NP_001095886.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Kininogen 1 (KNG1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 545-644 of human Kininogen 1 (KNG1) (NP_001095886.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16016A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Kininogen 1 (KNG1) |
| Target Synonyms | BK; HK; BDK; KNG; HAE6; HMWK; Kininogen 1 (KNG1) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, HepG2, Rat kidney, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 545-644 of human Kininogen 1 (KNG1) (NP_001095886.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PTPIPSLAKPGVTVTFSDFQDSDLIATMMPPISPAPIQSDDDWIPDIQIDPNGLSFNPISDFPDTTSPKCPGRPWKSVSEINPTTQMKESYYFDLTDGLS | Uniprot ID | P01042 |
Uniprot Id
P01042
Target Species
Human
Target Name
KNG1
Target Full Name
Kininogen-1
Target Function
(1) Kininogens are inhibitors of thiol proteases; (2) HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII; (3) HMW-kininogen inhibits the thrombin- and plasmin-induced aggregation of thrombocytes; (4) the active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects: (4A) influence in smooth muscle contraction, (4B) induction of hypotension, (4C) natriuresis and diuresis, (4D) decrease in blood glucose level, (4E) it is a mediator of inflammation and causes (4E1) increase in vascular permeability, (4E2) stimulation of nociceptors (4E3) release of other mediators of inflammation (e.g. prostaglandins), (4F) it has a cardioprotective effect (directly via bradykinin action, indirectly via endothelium-derived relaxing factor action); (5) LMW-kininogen inhibits the aggregation of thrombocytes; (6) LMW-kininogen is in contrast to HMW-kininogen not involved in blood clotting.
Target Involvement
High molecular weight kininogen deficiency (HMWK deficiency)
Target Subcellular Location
Secreted, extracellular space.
Target Tissue Specificity
Secreted in plasma. T-kinin is detected in malignant ovarian, colon and breast carcinomas, but not in benign tumors.
Target Research Area
Cardiovascular
Target Synonyms
Alpha-2-thiol proteinase inhibitor; BDK; BK; Bradykinin; Bradykinin included; Fitzgerald factor; FLAUJEAC FACTOR; High molecular weight kininogen; HMWK; Ile-Ser-Bradykinin; Kallidin I; Kallidin II; KNG; KNG1; KNG1_HUMAN; Low molecular weight growth-promoting factor; WILLIAMS FACTOR; Williams-Fitzgerald-Flaujeac factor
Target Background
This gene uses alternative splicing to generate two different proteins- high molecular weight kininogen (HMWK) and low molecular weight kininogen (LMWK). HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system. Also, bradykinin, a peptide causing numerous physiological effects, is released from HMWK. Bradykinin also functions as an antimicrobial peptide with antibacterial and antifungal activity. In contrast to HMWK, LMWK is not involved in blood coagulation. Infection with severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) reduces or depletes angiotensin converting enzyme 2 (ACE2), which results in an increase in levels of des-Arg(9)-bradykinin, a bioactive metabolite of bradykinin that is associated with lung injury and inflammation. Three transcript variants encoding different isoforms have been found for this gene.
Notification