-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LI Cadherin/Cadherin-17 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LI Cadherin/Cadherin-17 (Q12864) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against LI Cadherin/Cadherin-17 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LI Cadherin/Cadherin-17 (Q12864) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16219A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LI Cadherin/Cadherin-17 |
| Target Synonyms | HPT1; CDH16; HPT-1; LI Cadherin/Cadherin-17 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29 cells, Mouse large intestine | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LI Cadherin/Cadherin-17 (Q12864). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MILQAHLHSLCLLMLYLATGYGQEGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALD | Uniprot ID | Q12864 |
Uniprot Id
Q12864
Target Species
Human
Target Name
CDH17
Target Full Name
Cadherin-17
Target Function
Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. LI-cadherin may have a role in the morphological organization of liver and intestine. Involved in intestinal peptide transport.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Expressed in the gastrointestinal tract and pancreatic duct. Not detected in kidney, lung, liver, brain, adrenal gland and skin.
Target Synonyms
BILL-cadherin; CAD17_HUMAN; Cadherin 16; Cadherin 16; formerly; Cadherin 17; cadherin 17; LI cadherin (liver-intestine); cadherin; liver-intestine; Cadherin-17; CDH16; CDH16; formerly; Cdh17; FLJ26931 ; Formerly Cadherin 16; Formerly CDH16; HPT 1; HPT-1 cadherin; human intestinal peptide-associated transporter HPT-1; human peptide transporter 1; Intestinal peptide-associated transporter HPT 1; Intestinal peptide-associated transporter HPT-1; LI-cadherin; Liver Cadherin; liver intestine cadherin; Liver-intestine cadherin
Target Background
This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine. Alternative splicing results in multiple transcript variants.
Notification