-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LIS1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LIS1 (P43034) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against LIS1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LIS1 (P43034) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-13223A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LIS1 |
| Target Synonyms | MDS; LIS1; LIS2; MDCR; NudF; PAFAH | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse testis, U-87MG | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LIS1 (P43034). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPE | Uniprot ID | P43034 |
Uniprot Id
P43034
Target Species
Human
Target Name
PAFAH1B1
Target Full Name
Platelet-activating factor acetylhydrolase IB subunit beta
Target Function
Regulatory subunit (beta subunit) of the cytosolic type I platelet-activating factor (PAF) acetylhydrolase (PAF-AH (I)), an enzyme that catalyzes the hydrolyze of the acetyl group at the sn-2 position of PAF and its analogs and participates in PAF inactivation. Regulates the PAF-AH (I) activity in a catalytic dimer composition-dependent manner. Required for proper activation of Rho GTPases and actin polymerization at the leading edge of locomoting cerebellar neurons and postmigratory hippocampal neurons in response to calcium influx triggered via NMDA receptors. Positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein-mediated microtubule sliding by targeting dynein to the microtubule plus end. Required for several dynein- and microtubule-dependent processes such as the maintenance of Golgi integrity, the peripheral transport of microtubule fragments and the coupling of the nucleus and centrosome. Required during brain development for the proliferation of neuronal precursors and the migration of newly formed neurons from the ventricular/subventricular zone toward the cortical plate. Neuronal migration involves a process called nucleokinesis, whereby migrating cells extend an anterior process into which the nucleus subsequently translocates. During nucleokinesis dynein at the nuclear surface may translocate the nucleus towards the centrosome by exerting force on centrosomal microtubules. May also play a role in other forms of cell locomotion including the migration of fibroblasts during wound healing. Required for dynein recruitment to microtubule plus ends and BICD2-bound cargos. May modulate the Reelin pathway through interaction of the PAF-AH (I) catalytic dimer with VLDLR.
Target Involvement
Lissencephaly 1 (LIS1); Subcortical band heterotopia (SBH); Miller-Dieker lissencephaly syndrome (MDLS)
Target Subcellular Location
Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle. Nucleus membrane.
Target Protein Families
WD repeat LIS1/nudF family
Target Tissue Specificity
Fairly ubiquitous expression in both the frontal and occipital areas of the brain.
Target Synonyms
LIS 1; LIS 2; LIS-1; LIS1; LIS1_HUMAN; LIS2; Lissencephaly 1 protein; Lissencephaly-1 protein; MDCR; MDS; PAF acetylhydrolase 45 kDa subunit; PAF AH 45 kDa subunit; PAF AH alpha; PAF-AH 45 kDa subunit; PAF-AH alpha; PAFAH alpha; PAFAH; PAFAH1B1; PAFAHA; Platelet activating factor acetylhydrolase 1b regulatory subunit 1; Platelet activating factor acetylhydrolase isoform Ib alpha subunit; Platelet-activating factor acetylhydrolase IB subunit alpha
Target Background
This locus was identified as encoding a gene that when mutated or lost caused the lissencephaly associated with Miller-Dieker lissencephaly syndrome. This gene encodes the non-catalytic alpha subunit of the intracellular Ib isoform of platelet-activating factor acteylhydrolase, a heterotrimeric enzyme that specifically catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist: one composed of multiple subunits, the other, a single subunit. In addition, a single-subunit isoform of this enzyme is found in serum.
Notification