-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LTA4H was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 501-600 of human LTA4H (P09960) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against LTA4H was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 501-600 of human LTA4H (P09960) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14005A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LTA4H |
| Target Synonyms | LTA4H; leukotriene A4 hydrolase | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Hep G2, Mouse brain, Mouse lung, Mouse spleen, Rat kidney, Rat lung, U-937 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 501-600 of human LTA4H (P09960). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEDAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVT | Uniprot ID | P09960 |
Uniprot Id
P09960
Target Species
Human
Target Name
LTA4H
Target Full Name
Leukotriene A-4 hydrolase
Target Function
Bifunctional zinc metalloenzyme that comprises both epoxide hydrolase (EH) and aminopeptidase activities. Acts as an epoxide hydrolase to catalyze the conversion of LTA4 to the proinflammatory mediator leukotriene B4 (LTB4). Has also aminopeptidase activity, with high affinity for N-terminal arginines of various synthetic tripeptides. In addition to its proinflammatory EH activity, may also counteract inflammation by its aminopeptidase activity, which inactivates by cleavage another neutrophil attractant, the tripeptide Pro-Gly-Pro (PGP), a bioactive fragment of collagen generated by the action of matrix metalloproteinase-9 (MMP9) and prolylendopeptidase (PREPL). Involved also in the biosynthesis of resolvin E1 and 18S-resolvin E1 from eicosapentaenoic acid, two lipid mediators that show potent anti-inflammatory and pro-resolving actions.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Peptidase M1 family
Target Tissue Specificity
Isoform 1 and isoform 2 are expressed in monocytes, lymphocytes, neutrophils, reticulocytes, platelets and fibroblasts.
Target Synonyms
FLJ17564; Leukotriene A(4) hydrolase; Leukotriene A-4 hydrolase; Leukotriene A4 hydrolase; LKHA4_HUMAN; LTA-4 hydrolase; LTA4; LTA4 hydrolase; LTA4H
Target Background
The protein encoded by this gene is an enzyme that contains both hydrolase and aminopeptidase activities. The hydrolase activity is used in the final step of the biosynthesis of leukotriene B4, a proinflammatory mediator. The aminopeptidase activity has been shown to degrade proline-glycine-proline (PGP), a neutrophil chemoattractant and biomarker for chronic obstructive pulmonary disease (COPD). Several transcript variants encoding different isoforms have been found for this gene.
Notification