-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LYRIC/AEG1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 308-407 of human LYRIC/AEG1 (NP_848927.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against LYRIC/AEG1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 308-407 of human LYRIC/AEG1 (NP_848927.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
| Cat.No | ADA-15419A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LYRIC/AEG1 |
| Target Synonyms | 3D3; AEG1; AEG-1; LYRIC; LYRIC/3D3; LYRIC/AEG1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 308-407 of human LYRIC/AEG1 (NP_848927.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPASAGKRKTEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIGSTAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPNSDWNAPAEEWGNWVDE | Uniprot ID | Q86UE4 |
Uniprot Id
Q86UE4
Target Species
Human
Target Name
MTDH
Target Full Name
Protein LYRIC
Target Function
Downregulates SLC1A2/EAAT2 promoter activity when expressed ectopically. Activates the nuclear factor kappa-B (NF-kappa-B) transcription factor. Promotes anchorage-independent growth of immortalized melanocytes and astrocytes which is a key component in tumor cell expansion. Promotes lung metastasis and also has an effect on bone and brain metastasis, possibly by enhancing the seeding of tumor cells to the target organ endothelium. Induces chemoresistance.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein. Cell junction, tight junction. Nucleus, nucleolus. Cytoplasm, perinuclear region.
Target Tissue Specificity
Widely expressed with highest levels in muscle-dominating organs such as skeletal muscle, heart, tongue and small intestine and in endocrine glands such as thyroid and adrenal gland. Overexpressed in various cancers including breast, brain, prostate, mela
Target Synonyms
3D3; 3D3/LYRIC; AEG 1; AEG-1; AEG1; Astrocyte elevated gene 1; Astrocyte elevated gene-1 protein; LYRIC; LYRIC/3D3; LYRIC_HUMAN; Lysine rich CEACAM1 associated protein; Lysine rich CEACAM1 co isolated protein; Lysine-rich CEACAM1 co-isolated protein; Metadherin; Metastasis adhesion protein; MTDH; Protein LYRIC
Target Background
Enables NF-kappaB binding activity; double-stranded RNA binding activity; and transcription coactivator activity. Involved in several processes, including lipopolysaccharide-mediated signaling pathway; positive regulation of intracellular signal transduction; and regulation of transcription, DNA-templated. Located in endoplasmic reticulum; nuclear lumen; and perinuclear region of cytoplasm. Implicated in hepatocellular carcinoma.
Notification