-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MCM5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 635-734 of human MCM5 (P33992) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
The antibody against MCM5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 635-734 of human MCM5 (P33992) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
| Cat.No | ADA-16089A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MCM5 |
| Target Synonyms | CDC46; MGORS8; P1-CDC46; MCM5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, MCF7, Mouse spleen, Rat testis | Application | ELISA, WB, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 635-734 of human MCM5 (P33992). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ADVEEALRLFQVSTLDAALSGTLSGVEGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLRRGEIQHRMQRKVLYRLK | Uniprot ID | P33992 |
Uniprot Id
P33992
Target Species
Human
Target Name
MCM5
Target Full Name
DNA replication licensing factor MCM5
Target Function
Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity.
Target Involvement
Meier-Gorlin syndrome 8 (MGORS8)
Target Subcellular Location
Nucleus. Chromosome. Cytoplasm, cytosol.
Target Protein Families
MCM family
Target Synonyms
CDC 46; CDC46; CDC46 homolog; Cell division cycle 46; DNA replication licensing factor; DNA replication licensing factor MCM 5; DNA replication licensing factor MCM5; MCM 5; MCM5; MCM5_HUMAN; MGC5315; Minichromosome maintenance complex component 5; Minichromosome maintenance deficient (S. cerevisiae) 5; Minichromosome maintenance deficient 5; Minichromosome maintenance deficient protein 5; P1 CDC46; P1-CDC46
Target Background
The protein encoded by this gene is structurally very similar to the CDC46 protein from S. cerevisiae, a protein involved in the initiation of DNA replication. The encoded protein is a member of the MCM family of chromatin-binding proteins and can interact with at least two other members of this family. The encoded protein is upregulated in the transition from the G0 to G1/S phase of the cell cycle and may actively participate in cell cycle regulation.
Notification