-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against METAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 380-478 of human METAP2 (NP_006829.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against METAP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 380-478 of human METAP2 (NP_006829.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14141A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | METAP2 |
| Target Synonyms | MAP2; MNPEP; p67eIF2; METAP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, NIH/3T3, DU-145, HT-1080, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 380-478 of human METAP2 (NP_006829.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWLDRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY | Uniprot ID | P50579 |
Uniprot Id
P50579
Target Species
Human
Target Name
METAP2
Target Full Name
Methionine aminopeptidase 2
Target Function
Cotranslationally removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). The catalytic activity of human METAP2 toward Met-Val peptides is consistently two orders of magnitude higher than that of METAP1, suggesting that it is responsible for processing proteins containing N-terminal Met-Val and Met-Thr sequences in vivo.; Protects eukaryotic initiation factor EIF2S1 from translation-inhibiting phosphorylation by inhibitory kinases such as EIF2AK2/PKR and EIF2AK1/HCR. Plays a critical role in the regulation of protein synthesis.
Target Subcellular Location
Cytoplasm. Note=About 30% of expressed METAP2 associates with polysomes.
Target Protein Families
Peptidase M24A family, Methionine aminopeptidase eukaryotic type 2 subfamily
Target Research Area
Metabolism
Target Synonyms
A930035J23Rik; AI047573; AL024412; Amp2; AU014659,; EIF 2 associated p67 homolog; EIF-2-associated p67; Initiation factor 2 associated 67 kDa glycoprotein; Initiation factor 2-associated 67 kDa glycoprotein; MAP 2; MAP2; MAP2_HUMAN; MetAP 2; Metap2; Methionine aminopeptidase 2; Methionyl aminopeptidase 2; MGC102452; MGC127390; MGC53792; MNPEP; p67; p67eIF2; Peptidase M; Peptidase M2
Target Background
The protein encoded by this gene is a member of the methionyl aminopeptidase family. The encoded protein functions both by protecting the alpha subunit of eukaryotic initiation factor 2 from inhibitory phosphorylation and by removing the amino-terminal methionine residue from nascent proteins. Increased expression of this gene is associated with various forms of cancer, and the anti-cancer drugs fumagillin and ovalicin inhibit the protein by irreversibly binding to its active site. Inhibitors of this gene have also been shown to be effective for the treatment of obesity. A pseudogene of this gene is located on chromosome 2. Several transcript variants encoding different isoforms have been found for this gene.
Notification