-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MICA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human MICA (Q29983) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MICA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human MICA (Q29983) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13525A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MICA |
| Target Synonyms | MIC-A; PERB11.1; MICA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, MCF7, Mouse stomach, OVCAR3, Rat stomach | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MICA (Q29983). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEW | Uniprot ID | Q29983 |
Uniprot Id
Q29983
Target Species
Human
Target Name
MICA
Target Full Name
MHC class I polypeptide-related sequence A
Target Function
Seems to have no role in antigen presentation. Acts as a stress-induced self-antigen that is recognized by gamma delta T-cells. Ligand for the KLRK1/NKG2D receptor. Binding to KLRK1 leads to cell lysis.
Target Involvement
Psoriasis 1 (PSORS1); Psoriatic arthritis (PSORAS)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cytoplasm.
Target Protein Families
MHC class I family, MIC subfamily
Target Tissue Specificity
Widely expressed with the exception of the central nervous system where it is absent. Expressed predominantly in gastric epithelium and also in monocytes, keratinocytes, endothelial cells, fibroblasts and in the outer layer of Hassal's corpuscles within t
Target Synonyms
MHC class I chain-related protein A; MHC class I chain-related protein B; MHC class I polypeptide related sequence A; MHC class I polypeptide related sequence B; MHC class I polypeptide-related sequence A; MIC-A; micA; MICA_HUMAN; MICB
Target Background
This gene encodes the highly polymorphic major histocompatability complex class I chain-related protein A. The protein product is expressed on the cell surface, although unlike canonical class I molecules it does not seem to associate with beta-2-microglobulin. It is a ligand for the NKG2-D type II integral membrane protein receptor. The protein functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. Variations in this gene have been associated with susceptibility to psoriasis 1 and psoriatic arthritis, and the shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma. Alternative splicing of this gene results in multiple transcript variants.
Notification