Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRRF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 163-262 of human MRRF (Q96E11) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MRRF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 163-262 of human MRRF (Q96E11) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13425A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRRF |
| Target Synonyms | RRF; MRFF; MTRRF; MRRF | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, 293T, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 163-262 of human MRRF (Q96E11). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RESGMNLNPEVEGTLIRVPIPQVTREHREMLVKLAKQNTNKAKDSLRKVRTNSMNKLKKSKDTVSEDTIRLIEKQISQMADDTVAELDRHLAVKTKELLG | Uniprot ID | Q96E11 |
Uniprot Id
Q96E11
Target Species
Human
Target Name
MRRF
Target Full Name
Ribosome-recycling factor, mitochondrial
Target Function
Responsible for the release of ribosomes from messenger RNA at the termination of protein biosynthesis. May increase the efficiency of translation by recycling ribosomes from one round of translation to another.
Target Subcellular Location
Mitochondrion.
Target Protein Families
RRF family
Target Synonyms
2400002D02Rik; MGC93722; mitochondrial; mitochondrial ribosome recycling factor; MRFF; Mrrf; MTRRF; OTTHUMP00000022037; OTTMUSP00000013027; Ribosome recycling factor; mitochondrial; Ribosome recycling factor; mitochondrial precursor; Ribosome-recycling factor; Ribosome-releasing factor; Ribosome-releasing factor; mitochondrial; RP23-324A16.1; RRF; RRFM_HUMAN
Target Background
This gene encodes a ribosome recycling factor, which is a component of the mitochondrial translational machinery. The encoded protein, along with mitochondrial elongation factor 2, functions in ribosomal recycling at the termination of mitochondrial translation by mediating the disassembly of ribosomes from messenger RNA. A pseudogene of this gene has been identified on chromosome X.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
