Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Myoglobin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-154 of human Myoglobin(NP_005359.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Myoglobin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-154 of human Myoglobin(NP_005359.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-15690A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Myoglobin |
| Target Synonyms | MYOSB; PVALB; Myoglobin | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, Mouse skeletal muscle | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 2-154 of human Myoglobin(NP_005359.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG | Uniprot ID | P02144 |
Uniprot Id
P02144
Target Species
Human
Target Name
MB
Target Full Name
Myoglobin
Target Function
Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.
Target Protein Families
Globin family
Target Synonyms
MYOSB; PVALB; Myoglobin
Target Background
This gene encodes a member of the globin superfamily and is predominantly expressed in skeletal and cardiac muscles. The encoded protein forms a monomeric globular haemoprotein that is primarily responsible for the storage and facilitated transfer of oxygen from the cell membrane to the mitochondria. This protein also plays a role in regulating physiological levels of nitric oxide. Multiple transcript variants encoding distinct isoforms exist for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
