-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NEDD4L was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 876-975 of human NEDD4L (Q96PU5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NEDD4L was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 876-975 of human NEDD4L (Q96PU5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16731A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NEDD4L |
| Target Synonyms | RSP5; PVNH7; NEDD4-2; NEDD4.2; hNEDD4-2; NEDD4L | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, K-562 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 876-975 of human NEDD4L (Q96PU5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFEGVD | Uniprot ID | Q96PU5 |
Uniprot Id
Q96PU5
Target Species
Human
Target Name
NEDD4L
Target Full Name
E3 ubiquitin-protein ligase NEDD4-like
Target Function
E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Inhibits TGF-beta signaling by triggering SMAD2 and TGFBR1 ubiquitination and proteasome-dependent degradation. Promotes ubiquitination and internalization of various plasma membrane channels such as ENaC, SCN2A/Nav1.2, SCN3A/Nav1.3, SCN5A/Nav1.5, SCN9A/Nav1.7, SCN10A/Nav1.8, KCNA3/Kv1.3, KCNH2, EAAT1, KCNQ2/Kv7.2, KCNQ3/Kv7.3 or CLC5. Promotes ubiquitination and degradation of SGK1 and TNK2. Ubiquitinates BRAT1 and this ubiquitination is enhanced in the presence of NDFIP1. Plays a role in dendrite formation by melanocytes. Involved in the regulation of TOR signaling. Ubiquitinates and regulates protein levels of NTRK1 once this one is activated by NGF.
Target Involvement
Periventricular nodular heterotopia 7 (PVNH7)
Target Subcellular Location
Cytoplasm. Golgi apparatus. Endosome, multivesicular body. Note=May be recruited to exosomes by NDFIP1.
Target Tissue Specificity
Ubiquitously expressed, with highest levels in prostate, pancreas and kidney. Expressed in melanocytes.
Target Research Area
Cell Biology
Target Synonyms
E3 ubiquitin protein ligase NEDD4 like protein; E3 ubiquitin-protein ligase NEDD4-like; KIAA0439; NED4L_HUMAN; NEDD4 2; NEDD4 2c; Nedd4-2; NEDD4-2a; NEDD4.2; NEDD4b; NEDD4L; NEDD4La; NEDD4Lb; NEDD4Lc; NEDD4Ld; NEDD4Le; NEDD4Lf; NEDD4Lg; NEDD4Lh; NEDL3; Neural precursor cell expressed developmentally down regulated 4 like E3 ubiquitin protein ligase; Neural precursor cell expressed; developmentally down regulated 4 like; RSP5; Ubiquitin protein ligase Rsp5
Target Background
This gene encodes a member of the Nedd4 family of HECT domain E3 ubiquitin ligases. HECT domain E3 ubiquitin ligases transfer ubiquitin from E2 ubiquitin-conjugating enzymes to protein substrates, thus targeting specific proteins for lysosomal degradation. The encoded protein mediates the ubiquitination of multiple target substrates and plays a critical role in epithelial sodium transport by regulating the cell surface expression of the epithelial sodium channel, ENaC. Single nucleotide polymorphisms in this gene may be associated with essential hypertension. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Notification