-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NeuN was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NeuN (A6NFN3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NeuN was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NeuN (A6NFN3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16968A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NeuN |
| Target Synonyms | FOX3; NEUN; FOX-3; HRNBP3; NeuN | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NeuN (A6NFN3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR | Uniprot ID | A6NFN3 |
Uniprot Id
A6NFN3
Target Species
Human
Target Name
RBFOX3
Target Full Name
RNA binding protein fox-1 homolog 3
Target Function
Pre-mRNA alternative splicing regulator. Regulates alternative splicing of RBFOX2 to enhance the production of mRNA species that are targeted for nonsense-mediated decay (NMD).
Target Subcellular Location
Nucleus. Cytoplasm.
Target Synonyms
FLJ56884; FLJ58356; Fox-1 homolog C; fox1 homolog C; Fox3; FOX3NeuN; hexaribonucleotide binding protein 3; HRNBP3; NEUN; neuronal nuclei; Rbfox3; RFOX3_HUMAN; RNA binding protein fox-1 homolog 3; RNA binding protein, fox 1 homolog (C. elegans) 3
Target Background
This gene encodes a member of the RNA-binding FOX protein family which is involved in the regulation of alternative splicing of pre-mRNA. The protein has an N-terminal proline-rich region, an RNA recognition motif (RRM) domain, and a C-terminal alanine-rich region. This gene produces the neuronal nuclei (NeuN) antigen that has been widely used as a marker for post-mitotic neurons. This gene has its highest expression in the central nervous system and plays a prominent role in neural tissue development and regulation of adult brain function. Mutations in this gene have been associated with numerous neurological disorders. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.
Notification