-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Neutrophil Elastase (ELANE) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 167-267 of human Neutrophil Elastase (ELANE) (P08246) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against Neutrophil Elastase (ELANE) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 167-267 of human Neutrophil Elastase (ELANE) (P08246) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-16494A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Neutrophil Elastase (ELANE) |
| Target Synonyms | GE; NE; HLE; HNE; ELA2; SCN1; PMN-E; Neutrophil Elastase (ELANE) | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | THP-1, U-937 | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 167-267 of human Neutrophil Elastase (ELANE) (P08246). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH | Uniprot ID | P08246 |
Uniprot Id
P08246
Target Species
Human
Target Name
ELANE
Target Full Name
Neutrophil elastase
Target Function
Modifies the functions of natural killer cells, monocytes and granulocytes. Inhibits C5a-dependent neutrophil enzyme release and chemotaxis. Capable of killing E.coli but not S.aureus in vitro; digests outer membrane protein A (ompA) in E.coli and K.pneumoniae.
Target Involvement
Cyclic haematopoiesis (CH); Neutropenia, severe congenital 1, autosomal dominant (SCN1)
Target Subcellular Location
Cytoplasmic vesicle, phagosome.
Target Protein Families
Peptidase S1 family, Elastase subfamily
Target Tissue Specificity
Bone marrow cells. Neutrophil.
Target Research Area
Immunology, Signal Transduction
Target Synonyms
Bone marrow serine protease; ELA2; ELANE; Elastase 2; Elastase 2 neutrophil; Elastase neutrophil expressed; Elastase-2; ELNE_HUMAN; GE; Granulocyte derived elastase; HLE; HNE; Human leukocyte elastase; Leukocyte elastase; Medullasin; NE; Neutrophil elastase; PMN E; PMN elastase; Polymorphonuclear elastase; SCN1
Target Background
Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode structurally similar proteins. The encoded preproprotein is proteolytically processed to generate the active protease. Following activation, this protease hydrolyzes proteins within specialized neutrophil lysosomes, called azurophil granules, as well as proteins of the extracellular matrix. The enzyme may play a role in degenerative and inflammatory diseases through proteolysis of collagen-IV and elastin. This protein also degrades the outer membrane protein A (OmpA) of E. coli as well as the virulence factors of such bacteria as Shigella, Salmonella and Yersinia. Mutations in this gene are associated with cyclic neutropenia and severe congenital neutropenia (SCN). This gene is present in a gene cluster on chromosome 19.
Notification