-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NFYA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 262-332 of human NFYA (NP_002496.1?) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ChIP, ELISA.
The antibody against NFYA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 262-332 of human NFYA (NP_002496.1?) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ChIP, ELISA.
| Cat.No | ADA-15782A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NFYA |
| Target Synonyms | HAP2; CBF-A; CBF-B; NF-YA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293F | Application | ELISA, WB, ChIP, IHC-P, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 262-332 of human NFYA (NP_002496.1?). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDP | Uniprot ID | P23511 |
Uniprot Id
P23511
Target Species
Human
Target Name
NFYA
Target Full Name
Nuclear transcription factor Y subunit alpha
Target Function
Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on its interacting cofactors. NF-YA positively regulates the transcription of the core clock component ARNTL/BMAL1.
Target Subcellular Location
Nucleus.
Target Protein Families
NFYA/HAP2 subunit family
Target Synonyms
CAAT box DNA binding protein subunit A ; CAAT box DNA-binding protein subunit A; CBF A; CBF B; CBFA; CBFB; CCAAT binding transcription factor subunit B; FLJ11236; HAP 2; HAP2; HAP2 CCAAT binding protein; NF YA; NF-YA; NFY protein chain A ; NFYA; NFYA_HUMAN; NUCLEAR FACTOR BINDING TO Y BOX OF HLA GENES; Nuclear transcription factor Y alpha; Nuclear transcription factor Y; Nuclear transcription factor Y subunit A; Nuclear transcription factor Y subunit alpha; Sez10; Transcription factor NF Y A subunit
Target Background
The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds to CCAAT motifs in the promoter regions in a variety of genes. Subunit A associates with a tight dimer composed of the B and C subunits, resulting in a trimer that binds to DNA with high specificity and affinity. The sequence specific interactions of the complex are made by the A subunit, suggesting a role as the regulatory subunit. In addition, there is evidence of post-transcriptional regulation in this gene product, either by protein degradation or control of translation. Further regulation is represented by alternative splicing in the glutamine-rich activation domain, with clear tissue-specific preferences for the two isoforms.
Notification