Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NOXA2/p67phox was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human NOXA2/p67phox (P19878) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against NOXA2/p67phox was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human NOXA2/p67phox (P19878) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16036A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NOXA2/p67phox |
| Target Synonyms | NCF-2; NOXA2; P67PHOX; P67-PHOX; NOXA2/p67phox | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Rat lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human NOXA2/p67phox (P19878). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GKATVVASVVDQDSFSGFAPLQPQAAEPPPRPKTPEIFRALEGEAHRVLFGFVPETKEELQVMPGNIVFVLKKGNDNWATVMFNGQKGLVPCNYLEPVELR | Uniprot ID | P19878 |
Uniprot Id
P19878
Target Species
Human
Target Name
NCF2
Target Full Name
Neutrophil cytosol factor 2
Target Function
NCF2, NCF1, and a membrane bound cytochrome b558 are required for activation of the latent NADPH oxidase (necessary for superoxide production).
Target Involvement
Granulomatous disease, chronic, cytochrome-b-positive 2, autosomal recessive (CGD2)
Target Subcellular Location
Cytoplasm.
Target Protein Families
NCF2/NOXA1 family
Target Synonyms
67 kDa neutrophil oxidase factor; Chronic granulomatous disease autosomal 2; FLJ93058; NADPH oxidase activator 2; NCF-2; Ncf2; NCF2_HUMAN; Neutrophil cytosol factor 2; Neutrophil cytosolic factor 2 (65kD, chronic granulomatous disease, autosomal 2); Neutrophil NADPH oxidase factor 2; NOXA2; P67 PHOX; p67-phox; p67phox
Target Background
This gene encodes neutrophil cytosolic factor 2, the 67-kilodalton cytosolic subunit of the multi-protein NADPH oxidase complex found in neutrophils. This oxidase produces a burst of superoxide which is delivered to the lumen of the neutrophil phagosome. Mutations in this gene, as well as in other NADPH oxidase subunits, can result in chronic granulomatous disease, a disease that causes recurrent infections by catalase-positive organisms. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
