-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NUDEL/NDEL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUDEL/NDEL1 (Q9GZM8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NUDEL/NDEL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUDEL/NDEL1 (Q9GZM8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13807A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NUDEL/NDEL1 |
| Target Synonyms | EOPA; NDE2; NUDEL; MITAP1; NDE1L1; NUDEL/NDEL1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Rat heart, A-549, HepG2, Mouse brain, Mouse lung, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUDEL/NDEL1 (Q9GZM8). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQRLKYEVEALKEKLEHQYAQSYKQVSVLEDD | Uniprot ID | Q9GZM8 |
Uniprot Id
Q9GZM8
Target Species
Human
Target Name
NDEL1
Target Full Name
Nuclear distribution protein nudE-like 1
Target Function
Required for organization of the cellular microtubule array and microtubule anchoring at the centrosome. May regulate microtubule organization at least in part by targeting the microtubule severing protein KATNA1 to the centrosome. Also positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein-mediated microtubule sliding by targeting dynein to the microtubule plus ends. Required for several dynein- and microtubule-dependent processes such as the maintenance of Golgi integrity, the centripetal motion of secretory vesicles and the coupling of the nucleus and centrosome. Also required during brain development for the migration of newly formed neurons from the ventricular/subventricular zone toward the cortical plate. Plays a role, together with DISC1, in the regulation of neurite outgrowth. Required for mitosis in some cell types but appears to be dispensible for mitosis in cortical neuronal progenitors, which instead requires NDE1. Facilitates the polymerization of neurofilaments from the individual subunits NEFH and NEFL. Positively regulates lysosome peripheral distribution and ruffled border formation in osteoclasts.
Target Subcellular Location
Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Chromosome, centromere, kinetochore. Cytoplasm, cytoskeleton, spindle.
Target Protein Families
NudE family
Target Tissue Specificity
Expressed in brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle.
Target Research Area
Neuroscience
Target Synonyms
A. nidulans; DKFZp451M0318; ENDOOLIGOPEPTIDASE A; EOPA; MITAP 1; MITAP1; Mitosin associated protein 1; Mitosin associated protein MITAP1; Mitosin-associated protein 1; Ndel 1; NDEL1; NDEL1_HUMAN; Nuclear distribution gene E like homolog 1; Nuclear distribution protein nudE like 1; Nuclear distribution protein nudE-like 1; NUDE like protein; NudE nuclear distribution gene E homolog like 1 A. nidulans; NudE nuclear distribution gene E homolog like 1; NUDEL; Protein Nudel
Target Background
Enables identical protein binding activity. Involved in chromosome segregation; positive regulation of GTPase activity; and regulation of intracellular protein transport. Located in kinetochore. Biomarker of schizophrenia.
Notification