Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ORP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 851-950 of human ORP1 (Q9BXW6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ORP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 851-950 of human ORP1 (Q9BXW6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13219A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ORP1 |
| Target Synonyms | ORP1; ORP-1; OSBPL1B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat brain, 293T, Mouse brain, Mouse spleen, Rat liver, SH-SY5Y | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 851-950 of human ORP1 (Q9BXW6). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SFAMVLNEVDKDMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQRAARKNRSKSEEDWKTRWFHQGPNPYNGAQDWIYSGSYWDRNYFNLPDIY | Uniprot ID | Q9BXW6 |
Uniprot Id
Q9BXW6
Target Species
Human
Target Name
OSBPL1A
Target Full Name
Oxysterol-binding protein-related protein 1
Target Function
Binds phospholipids; exhibits strong binding to phosphatidic acid and weak binding to phosphatidylinositol 3-phosphate. Stabilizes GTP-bound RAB7A on late endosomes/lysosomes and alters functional properties of late endocytic compartments via its interaction with RAB7A. Binds 25-hydroxycholesterol and cholesterol.
Target Subcellular Location
Late endosome. Note=Colocalizes with RAB7A, RAB9A and LAMP1 in late endosomes.
Target Protein Families
OSBP family
Target Synonyms
FLJ10217; ORP 1; ORP-1; ORP1; OSBL1_HUMAN; OSBP 8; OSBP L1; OSBP related protein 1; OSBP-related protein 1; OSBP8; OSBPL 1; OSBPL 1A; OSBPL 1B; OSBPL1; OSBPL1A; OSBPL1B; Oxysterol binding protein like 1A; Oxysterol binding protein like 1B; Oxysterol binding protein related protein 1; Oxysterol-binding protein-related protein 1
Target Background
This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. Transcript variants derived from alternative promoter usage and/or alternative splicing exist; they encode different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
